1. Recombinant Proteins
  2. Cytokines and Growth Factors Biotinylated Proteins
  3. TNF Superfamily
  4. TNF Superfamily Ligands
  5. TL1A
  6. TL1A/TNFSF15 Protein, Human (Biotinylated, HEK293, Avi-His)

TL1A/TNFSF15 Protein, Human (Biotinylated, HEK293, Avi-His)

Cat. No.: HY-P702569
Handling Instructions Technical Support

TL1A/TNFSF15 Protein, the receptor for TNFRSF25 and TNFRSF6B, activates NF-kappa-B and promotes caspase activation, leading to apoptosis. It also inhibits vascular endothelial growth and angiogenesis in vitro. Operating as a homotrimer, it plays a crucial role in diverse cellular processes, including immune response and apoptosis regulation. TL1A/TNFSF15 Protein, Human (Biotinylated, HEK293, Avi-His) is the recombinant human-derived TL1A/TNFSF15 protein, expressed by HEK293 , with N-10*His, N-Avi labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
20 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
> 100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

TL1A/TNFSF15 Protein, the receptor for TNFRSF25 and TNFRSF6B, activates NF-kappa-B and promotes caspase activation, leading to apoptosis. It also inhibits vascular endothelial growth and angiogenesis in vitro. Operating as a homotrimer, it plays a crucial role in diverse cellular processes, including immune response and apoptosis regulation. TL1A/TNFSF15 Protein, Human (Biotinylated, HEK293, Avi-His) is the recombinant human-derived TL1A/TNFSF15 protein, expressed by HEK293 , with N-10*His, N-Avi labeled tag.

Background

TL1A/TNFSF15 Protein acts as the receptor for TNFRSF25 and TNFRSF6B, facilitating the activation of NF-kappa-B and promoting the activation of caspases, leading to apoptosis. Additionally, it exhibits inhibitory effects on vascular endothelial growth and angiogenesis in vitro. The protein functions as a homotrimer, underscoring its role in diverse cellular processes, including immune response and apoptosis regulation.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF15 at 2 μg/mL on streptavidin coated plates can bind Anti-TNFSF15 antibody. The EC50 is 0.6647-13.46 ng/mL.

Species

Human

Source

HEK293

Tag

N-10*His;N-Avi

Accession

O95150-1 (L72-L251)

Gene ID

9966

Molecular Construction
N-term
Avi-10*His
TL1A (L72-L251)
Accession # O95150-1
C-term
Protein Length

Partial

Conjugation

Biotin

Conjugate Method

The single lysine residue in Avitag is biotinylated through an enzymatic reaction.

Synonyms
MGC129934; MGC129935; TL1 A; tl1; tl1a; tnf ligand related molecule 1; TNF ligand-related molecule 1; tnf superfamily ligand tl1a; TNF15_HUMAN; TNFSF15; Tumor necrosis factor ligand; superfamily member 15; Tumor necrosis factor ligand superfamily member 15; Tumor necrosis factor ligand superfamily member 15, secreted form;
AA Sequence

LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL

Predicted Molecular Mass
25.4 kDa
분자량

Approximately 25-38 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

TL1A/TNFSF15 Protein, Human (Biotinylated, HEK293, Avi-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

TL1A/TNFSF15 Protein, Human (Biotinylated, HEK293, Avi-His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
TL1A/TNFSF15 Protein, Human (Biotinylated, HEK293, Avi-His)
Cat. No.:
HY-P702569
수량:
MCE Japan Authorized Agent: