1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TNF Superfamily
  4. TNF Superfamily Ligands
  5. TL1A
  6. TL1A/TNFSF15 Protein, Cynomolgus/Rhesus macaque (HEK293, His)

TL1A/TNFSF15 Protein, Cynomolgus/Rhesus macaque (HEK293, His)

Cat. No.: HY-P701047
Instrucciones de manejo Technical Support

The TL1A/TNFSF15 protein is an important member of the tumor necrosis factor family and is critical for immune regulation and cellular responses. Its study enhances our understanding of immune regulation, providing potential applications for immunoassay and therapeutic development. TL1A/TNFSF15 Protein, Cynomolgus/Rhesus macaque (HEK293, His) is the recombinant Rhesus Macaque, cynomolgus-derived TL1A/TNFSF15 protein, expressed by HEK293 , with N-His labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
Muestra gratis   Apply now
Muestra gratis   Apply now
2 μg En stock
10 μg En stock
20 μg En stock
50 μg En stock
100 μg En stock
500 μg En stock
1 mg En stock
> 1 mg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

The TL1A/TNFSF15 protein is an important member of the tumor necrosis factor family and is critical for immune regulation and cellular responses. Its study enhances our understanding of immune regulation, providing potential applications for immunoassay and therapeutic development. TL1A/TNFSF15 Protein, Cynomolgus/Rhesus macaque (HEK293, His) is the recombinant Rhesus Macaque, cynomolgus-derived TL1A/TNFSF15 protein, expressed by HEK293 , with N-His labeled tag.

Background

The TL1A/TNFSF15 Protein is a significant member of the tumor necrosis factor family, underlining its essential role in immune regulation and cellular responses. As part of this family, TL1A/TNFSF15 Trimer likely shares conserved structural and functional features with related proteins, emphasizing its involvement in signaling pathways associated with immune modulation. The classification within the tumor necrosis factor family underscores its specific designation within the broader context of cytokines, providing insights into its unique contributions to T cell activation and co-stimulation. The study of TL1A/TNFSF15 Trimer Protein contributes to our understanding of its role in immune homeostasis, offering potential applications in various immunological assays and therapeutic developments. Further exploration of TL1A/TNFSF15 Trimer's role holds promise for enhancing our knowledge of its contributions to both normal immune function and pathological conditions.

Actividad biológica

1.Immobilized Cynomolgus/Rhesus macaque TNFSF15, His Tag at 1 μg/mL (100 μl/well) on the plate. Dose response curve for Anti-TNFSF15 Antibody, hFc Tag with the ED50 of <6 ng/mL determined by ELISA.
2.Mouse DR3 (HY-P700707), His Tag immobilized on CM5 Chip can bind Cynomolgus/Rhesus macaque TNFSF15, His Tag with an affinity constant of 5.117 nM as determined in SPR assay.
3. Immobilized Cynomolgus TNFSF15 Trimer at 2μg/mL (100 μL/Well) can bind Anti-TNFSF15 Antibody. The ED50 for this effect is 5.292 ng/mL.

  • Mouse DR3(HY-P700707), His Tag immobilized on CM5 Chip can bind Cynomolgus/Rhesus macaque TNFSF15, His Tag with an affinity constant of 5.117 nM as determined in SPR assay.
Species

Rhesus Macaque; Cynomolgus

Source

HEK293

Tag

N-His

Accession

F6S8F9-1/A0A2K5UA22 (L72-L251)

Gene ID
Molecular Construction
N-term
His
TL1A (L72-L251)
Accession # F6S8F9-1/A0A2K5UA22
C-term
Protein Length

Partial

Synonyms
TL1A; VEGI-251; TNFSF15; TL1; VEGI; VEGI192A; TNF superfamily member 15
AA Sequence

LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHLKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFVYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL

Predicted Molecular Mass
21.5 kDa
Peso molecular

Approximately 25-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Pureza
  • ≥ 90%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from 0.22 μm filtered solution in PBS (pH 7.4-8.0). Normally 8% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Documentación

TL1A/TNFSF15 Protein, Cynomolgus/Rhesus macaque (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

TL1A/TNFSF15 Protein, Cynomolgus/Rhesus macaque (HEK293, His)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
TL1A/TNFSF15 Protein, Cynomolgus/Rhesus macaque (HEK293, His)
Cat. No.:
HY-P701047
Cantidad:
MCE Japan Authorized Agent: