Copy Link Print Information

TNFRSF10C Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

The TNFRSF10C protein is a receptor for TRAIL and lacks a cytoplasmic death domain, making it unable to induce apoptosis. Instead, it protects cells by competing for ligand binding with TRAIL-R1 and R2, acting as a decoy receptor and mitigating TRAIL-mediated apoptosis. TNFRSF10C Protein, Human (HEK293, His) is the recombinant human-derived TNFRSF10C protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for TNFRSF10C Protein, Human (HEK293, His)
  • TNFRSF10C Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The TNFRSF10C protein is a receptor for TRAIL and lacks a cytoplasmic death domain, making it unable to induce apoptosis. Instead, it protects cells by competing for ligand binding with TRAIL-R1 and R2, acting as a decoy receptor and mitigating TRAIL-mediated apoptosis. TNFRSF10C Protein, Human (HEK293, His) is the recombinant human-derived TNFRSF10C protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The TNFRSF10C Protein serves as a receptor for the cytotoxic ligand TRAIL; however, it lacks a cytoplasmic death domain, rendering it incapable of inducing apoptosis. Instead, TNFRSF10C may play a protective role in cells by competing with TRAIL-R1 and R2 for binding to the ligand, potentially acting as a decoy receptor and thereby mitigating TRAIL-mediated apoptosis. This unique feature highlights the regulatory complexity of TNFRSF10C in modulating cellular responses to TRAIL signaling and suggests its involvement in fine-tuning the balance between survival and apoptotic pathways.

Verified Bioactivity

Measured by its ability to inhibit TRAIL-mediated cytotoxicity using L-929 mouse  fibroblast cells. The ED50 of this effect is less than 200 ng/mL in the presence  of 12 ng/mL of rhTRAIL.

MCE Validation Data

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to inhibit TRAIL-mediated cytotoxicity using L-929 mouse fibroblast cells. The ED50 of this effect is 17.17 ng/mL in the presence of 12 ng/mL of rhTRAIL, corresponding to a specific activity is 5.824×104 units/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    O14798 (A26-A221)

  • Gene ID
    8794  [NCBI]
  • Molecular Construction
    • N-term
    • TNFRSF10C (A26-A221)
      Accession # O14798
    • 6*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    TNFRSF10C; Decoy TRAIL Receptor Without Death Domain; TNF Receptor Superfamily Member 10c; Lymphocyte Inhibitor Of TRAIL; TRAILR3; Decoy Receptor 1; DcR1; TRAIL-R3; TRID; TRAIL Receptor Without An Intracellular Domain; LIT; Cytotoxic TRAIL Receptor-3; CD2

  • AA Sequence

    ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPA

  • Predicted Molecular Mass

    21.8 kDa

  • Molecular Weight

    Approximately 38-58 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     Measured by its ability to inhibit TRAIL-mediated cytotoxicity using L-929 mouse fibroblast cells. The ED50 of this effect is 17.17 ng/mL in the presence of 12 ng/mL of rhTRAIL, corresponding to a specific activity is 5.824×104 units/mg.

  • TNFRSF10C Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for TNFRSF10C Protein, Human (HEK293, His)
  • TNFRSF10C Protein, Human (HEK293, His) Product Image