TNFRSF10C Protein, Human (HEK293, His)

The TNFRSF10C protein is a receptor for TRAIL and lacks a cytoplasmic death domain, making it unable to induce apoptosis. Instead, it protects cells by competing for ligand binding with TRAIL-R1 and R2, acting as a decoy receptor and mitigating TRAIL-mediated apoptosis. TNFRSF10C Protein, Human (HEK293, His) is the recombinant human-derived TNFRSF10C protein, expressed by HEK293 , with C-6*His labeled tag.

The TNFRSF10C Protein serves as a receptor for the cytotoxic ligand TRAIL; however, it lacks a cytoplasmic death domain, rendering it incapable of inducing apoptosis. Instead, TNFRSF10C may play a protective role in cells by competing with TRAIL-R1 and R2 for binding to the ligand, potentially acting as a decoy receptor and thereby mitigating TRAIL-mediated apoptosis. This unique feature highlights the regulatory complexity of TNFRSF10C in modulating cellular responses to TRAIL signaling and suggests its involvement in fine-tuning the balance between survival and apoptotic pathways.

Measured by its ability to inhibit TRAIL-mediated cytotoxicity using L-929 mouse  fibroblast cells. The ED₅₀ of this effect is less than 200 ng/mL in the presence  of 12 ng/mL of rhTRAIL.

• 
  Measured by its ability to inhibit TRAIL-mediated cytotoxicity using L-929 mouse fibroblast cells. The ED₅₀ of this effect is 17.17 ng/mL in the presence of 12 ng/mL of rhTRAIL, corresponding to a specific activity is 5.824×10⁴ units/mg.

Human

HEK293

C-6*His

O14798 (A26-A221)

8794  [NCBI]

Partial

ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPA

Approximately 38-58 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.