1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TNF Superfamily
  4. TNF Receptor Superfamily
  5. Decoy Receptor 1
  6. TNFRSF10C Protein, Human (HEK293, His)

TNFRSF10C Protein, Human (HEK293, His)

Cat. No.: HY-P70815
COA Handling Instructions

The TNFRSF10C protein is a receptor for TRAIL and lacks a cytoplasmic death domain, making it unable to induce apoptosis. Instead, it protects cells by competing for ligand binding with TRAIL-R1 and R2, acting as a decoy receptor and mitigating TRAIL-mediated apoptosis. TNFRSF10C Protein, Human (HEK293, His) is the recombinant human-derived TNFRSF10C protein, expressed by HEK293 , with C-6*His labeled tag. The total length of TNFRSF10C Protein, Human (HEK293, His) is 196 a.a., with molecular weight of 50-60 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
10 μg $50 In-stock
50 μg $150 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The TNFRSF10C protein is a receptor for TRAIL and lacks a cytoplasmic death domain, making it unable to induce apoptosis. Instead, it protects cells by competing for ligand binding with TRAIL-R1 and R2, acting as a decoy receptor and mitigating TRAIL-mediated apoptosis. TNFRSF10C Protein, Human (HEK293, His) is the recombinant human-derived TNFRSF10C protein, expressed by HEK293 , with C-6*His labeled tag. The total length of TNFRSF10C Protein, Human (HEK293, His) is 196 a.a., with molecular weight of 50-60 kDa.

Background

The TNFRSF10C Protein serves as a receptor for the cytotoxic ligand TRAIL; however, it lacks a cytoplasmic death domain, rendering it incapable of inducing apoptosis. Instead, TNFRSF10C may play a protective role in cells by competing with TRAIL-R1 and R2 for binding to the ligand, potentially acting as a decoy receptor and thereby mitigating TRAIL-mediated apoptosis. This unique feature highlights the regulatory complexity of TNFRSF10C in modulating cellular responses to TRAIL signaling and suggests its involvement in fine-tuning the balance between survival and apoptotic pathways.

Biological Activity

Measured by its ability to inhibit TRAIL-mediated cytotoxicity using L‑929 mouse  fibroblast cells. The ED50 of this effect is less than 200 ng/mL in the presence  of 12 ng/mL of rhTRAIL.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

O14798 (A26-A221)

Gene ID
Molecular Construction
N-term
TNFRSF10C (A26-A221)
Accession # O14798
6*His
C-term
Synonyms
Tumor Necrosis Factor Receptor Superfamily Member 10C; Antagonist Decoy Receptor for TRAIL/Apo-2L; Decoy TRAIL Receptor Without Death Domain; Decoy Receptor 1; DcR1; Lymphocyte Inhibitor of TRAIL; TNF-Related Apoptosis-Inducing Ligand Receptor 3; TRAIL Receptor
AA Sequence

ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPA

Molecular Weight

50-60 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

TNFRSF10C Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TNFRSF10C Protein, Human (HEK293, His)
Cat. No.:
HY-P70815
Quantity:
MCE Japan Authorized Agent: