TREM-1 Protein, Human (180a.a, HEK293, His)

The TREM-1 protein is a cell surface receptor that critically regulates innate and adaptive immunity by enhancing inflammatory responses. TREM-1 plays a crucial role in acute and chronic inflammatory diseases, acting as a decoy receptor to balance its pro-inflammatory effects. TREM-1 Protein, Human (180a.a, HEK293, His) is the recombinant human-derived TREM-1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of TREM-1 Protein, Human (180a.a, HEK293, His) is 180 a.a., with molecular weight of 26-40 kDa.

TREM-1 protein, as a cell surface receptor, potentially participates in innate and adaptive immune responses. Following phosphorylation, it interacts with PTPN6 and PTPN11, indicating its role in signaling pathways linked to these phosphatases. This interaction highlights the regulatory mechanisms TREM-1 may contribute to in modulating the immune system.

Measured by its ability to block anti-TREM-1-induced TNF-alpha secretion by human myeloid leukemia mononuclear cells. At 1 µg/mL, Recombinant Human TREM-1 is able to block is 63% of Anti-Human TREM-1 (20 µg/mL, 200 µL/well) induced TNF-alpha released from 1 x 10⁵ cells.

Human

HEK293

C-6*His

Q9NP99 (A21-R200)

54210  [NCBI]

ATKLTEEKYELKEGQTLDVKCDYTLEKFASSQKAWQIIRDGEMPKTLACTERPSKNSHPVQVGRIILEDYHDHGLLRVRMVNLQVEDSGLYQCVIYQPPKEPHMLFDRIRLVVTKGFSGTPGSNENSTQNVYKIPPTTTKALCPLYTSPRTVTQAPPKSTADVSTPDSEINLTNVTDIIR

26-40 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2 or PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.