UBASH3A Protein, Human (His)

UBASH3A interferes with CBL-mediated downregulation and degradation of receptor-type tyrosine kinases and promotes the accumulation of activating receptors such as T cell receptors, EGFR and PDGFRB on the cell surface. It exhibits minimal protein tyrosine phosphatase activity and may act as a dominant negative regulator of UBASH3B-dependent dephosphorylation. UBASH3A Protein, Human (His) is the recombinant human-derived UBASH3A protein, expressed by E. coli , with N-His labeled tag. The total length of UBASH3A Protein, Human (His) is 270 a.a., with molecular weight of ~30 kDa.

UBASH3A protein disrupts the CBL-mediated down-regulation and degradation of receptor-type tyrosine kinases, leading to the accumulation of activated target receptors like T-cell receptors, EGFR, and PDGFRB on the cell surface. Despite minimal protein tyrosine phosphatase activity at neutral pH, UBASH3A may act as a dominant-negative regulator of UBASH3B-dependent dephosphorylation. Additionally, UBASH3A could potentially hinder dynamin-dependent endocytic pathways by functionally sequestering dynamin through its SH3 domain. It forms homodimers or homooligomers and interacts with CBL, playing a role in a complex with CBL and activated EGFR. Furthermore, UBASH3A interacts with ubiquitin and mono-ubiquitinated proteins, as well as with dynamin, contributing to its multifaceted regulatory functions.

Immobilized Human UBASH3A at 2 μg/mL (100 μL/well) can bind Anti-UBASH3A Antibody. The ED₅₀ for this effect is 1.463 μg/mL.

Human

E. coli

N-His

P57075-2 (A354-N623)

53347  [NCBI]

ATVARKSVLVVRHGERVDQIFGKAWLQQCSTPDGKYYRPDLNFPCSLPRRSRGIKDFENDPPLSSCGIFQSRIAGDALLDSGIRISSVFASPALRCVQTAKLILEELKLEKKIKIRVEPGIFEWTKWEAGKTTPTLMSLEELKEANFNIDTDYRPAFPLSALMPAESYQEYMDRCTASMVQIVNTCPQDTGVILIVSHGSTLDSCTRPLLGLPPRECGDFAQLVRKIPSLGMCFCEENKEEGKWELVNPPVKTLTHGANAAFNWRNWISGN

Approximately 30 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.