UBASH3A Protein, Human (His)
Based on 1 publication(s) in Google Scholar
UBASH3A interferes with CBL-mediated downregulation and degradation of receptor-type tyrosine kinases and promotes the accumulation of activating receptors such as T cell receptors, EGFR and PDGFRB on the cell surface. It exhibits minimal protein tyrosine phosphatase activity and may act as a dominant negative regulator of UBASH3B-dependent dephosphorylation. UBASH3A Protein, Human (His) is the recombinant human-derived UBASH3A protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
UBASH3A interferes with CBL-mediated downregulation and degradation of receptor-type tyrosine kinases and promotes the accumulation of activating receptors such as T cell receptors, EGFR and PDGFRB on the cell surface. It exhibits minimal protein tyrosine phosphatase activity and may act as a dominant negative regulator of UBASH3B-dependent dephosphorylation. UBASH3A Protein, Human (His) is the recombinant human-derived UBASH3A protein, expressed by E. coli , with N-His labeled tag.
Background
UBASH3A protein disrupts the CBL-mediated down-regulation and degradation of receptor-type tyrosine kinases, leading to the accumulation of activated target receptors like T-cell receptors, EGFR, and PDGFRB on the cell surface. Despite minimal protein tyrosine phosphatase activity at neutral pH, UBASH3A may act as a dominant-negative regulator of UBASH3B-dependent dephosphorylation. Additionally, UBASH3A could potentially hinder dynamin-dependent endocytic pathways by functionally sequestering dynamin through its SH3 domain. It forms homodimers or homooligomers and interacts with CBL, playing a role in a complex with CBL and activated EGFR. Furthermore, UBASH3A interacts with ubiquitin and mono-ubiquitinated proteins, as well as with dynamin, contributing to its multifaceted regulatory functions.
Verified Bioactivity
Immobilized Human UBASH3A at 2 μg/mL (100 μL/well) can bind Anti-UBASH3A Antibody. The ED50 for this effect is 1.463 μg/mL.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Spectrochim Acta A Mol Biomol Spectrosc
A novel fluorescent probe with Aggregation-Induced emission characteristics for PTP1B activity sensing and inhibitor screening. [Abstract]2025 Feb 15:327:125394. PMID: 39520822
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
P57075-2 (A353-N623)
-
Molecular Construction
-
N-term
-
His
-
UBASH3A (A353-N623)
Accession # P57075-2 -
C-term
-
-
Protein Length
Partial
-
Synonyms
UBASH3A; Ubiquitin Associated And SH3 Domain Containing A; STS-2; CLIP4; TULA; Ubiquitin-Associated And SH3 Domain-Containing Protein A; Suppressor Of T-Cell Receptor Signaling 2; T-Cell Ubiquitin Ligand Protein; T-Cell Ubiquitin Ligand 1; Cbl-Interacting
-
AA Sequence
ATVARKSVLVVRHGERVDQIFGKAWLQQCSTPDGKYYRPDLNFPCSLPRRSRGIKDFENDPPLSSCGIFQSRIAGDALLDSGIRISSVFASPALRCVQTAKLILEELKLEKKIKIRVEPGIFEWTKWEAGKTTPTLMSLEELKEANFNIDTDYRPAFPLSALMPAESYQEYMDRCTASMVQIVNTCPQDTGVILIVSHGSTLDSCTRPLLGLPPRECGDFAQLVRKIPSLGMCFCEENKEEGKWELVNPPVKTLTHGANAAFNWRNWISGN
-
Predicted Molecular Mass
30.3 kDa
-
Molecular Weight
Approximately 30 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
