1. Recombinant Proteins
  2. Ubiquitin Related Proteins
  3. Ubiquitin Enzymes
  4. UBASH3A Protein, Human (His)

UBASH3A interferes with CBL-mediated downregulation and degradation of receptor-type tyrosine kinases and promotes the accumulation of activating receptors such as T cell receptors, EGFR and PDGFRB on the cell surface. It exhibits minimal protein tyrosine phosphatase activity and may act as a dominant negative regulator of UBASH3B-dependent dephosphorylation. UBASH3A Protein, Human (His) is the recombinant human-derived UBASH3A protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE UBASH3A Protein, Human (His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

UBASH3A interferes with CBL-mediated downregulation and degradation of receptor-type tyrosine kinases and promotes the accumulation of activating receptors such as T cell receptors, EGFR and PDGFRB on the cell surface. It exhibits minimal protein tyrosine phosphatase activity and may act as a dominant negative regulator of UBASH3B-dependent dephosphorylation. UBASH3A Protein, Human (His) is the recombinant human-derived UBASH3A protein, expressed by E. coli , with N-His labeled tag.

Background

UBASH3A protein disrupts the CBL-mediated down-regulation and degradation of receptor-type tyrosine kinases, leading to the accumulation of activated target receptors like T-cell receptors, EGFR, and PDGFRB on the cell surface. Despite minimal protein tyrosine phosphatase activity at neutral pH, UBASH3A may act as a dominant-negative regulator of UBASH3B-dependent dephosphorylation. Additionally, UBASH3A could potentially hinder dynamin-dependent endocytic pathways by functionally sequestering dynamin through its SH3 domain. It forms homodimers or homooligomers and interacts with CBL, playing a role in a complex with CBL and activated EGFR. Furthermore, UBASH3A interacts with ubiquitin and mono-ubiquitinated proteins, as well as with dynamin, contributing to its multifaceted regulatory functions.

Biological Activity

Immobilized Human UBASH3A at 2 μg/mL (100 μL/well) can bind Anti-UBASH3A Antibody. The ED50 for this effect is 1.463 μg/mL.

Species

Human

Source

E. coli

Tag

N-His

Accession

P57075-2 (A353-N623)

Gene ID
Molecular Construction
N-term
His
UBASH3A (A353-N623)
Accession # P57075-2
C-term
Protein Length

Partial

Synonyms
Ubiquitin-associated and SH3 domain-containing protein A; CLIP4; STS-2; TULA-1
AA Sequence

ATVARKSVLVVRHGERVDQIFGKAWLQQCSTPDGKYYRPDLNFPCSLPRRSRGIKDFENDPPLSSCGIFQSRIAGDALLDSGIRISSVFASPALRCVQTAKLILEELKLEKKIKIRVEPGIFEWTKWEAGKTTPTLMSLEELKEANFNIDTDYRPAFPLSALMPAESYQEYMDRCTASMVQIVNTCPQDTGVILIVSHGSTLDSCTRPLLGLPPRECGDFAQLVRKIPSLGMCFCEENKEEGKWELVNPPVKTLTHGANAAFNWRNWISGN

Predicted Molecular Mass
30.3 kDa
Molecular Weight

Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

UBASH3A Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

UBASH3A Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
UBASH3A Protein, Human (His)
Cat. No.:
HY-P76687
Quantity:
MCE Japan Authorized Agent: