1. Recombinant Proteins
  2. Ubiquitin Related Proteins
  3. Ubiquitin Enzymes
  4. E2 Enzymes
  5. Ubiquitin Conjugating Enzyme E2 L6
  6. UBE2L6 Protein, Human (His)

The UBE2L6 protein plays a key role in cell regulation by catalyzing the covalent attachment of ubiquitin or ISG15 to other proteins. Notably, it plays a role in E6/E6-AP-induced ubiquitination of p53/TP53, a core process in regulating cellular responses to stress and DNA damage. UBE2L6 Protein, Human (His) is the recombinant human-derived UBE2L6 protein, expressed by E. coli , with C-6*His labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
10 μg En stock
50 μg En stock
100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

The UBE2L6 protein plays a key role in cell regulation by catalyzing the covalent attachment of ubiquitin or ISG15 to other proteins. Notably, it plays a role in E6/E6-AP-induced ubiquitination of p53/TP53, a core process in regulating cellular responses to stress and DNA damage. UBE2L6 Protein, Human (His) is the recombinant human-derived UBE2L6 protein, expressed by E. coli , with C-6*His labeled tag.

Background

UBE2L6, also known as ubiquitin-conjugating enzyme E2L6, is a protein that catalyzes the covalent attachment of ubiquitin or ISG15 to other proteins, a process crucial for the regulation of protein stability and function. Specifically, UBE2L6 plays a role in the E6/E6-AP-induced ubiquitination of p53/TP53, a tumor suppressor protein involved in cell cycle regulation and apoptosis. Additionally, UBE2L6 is implicated in promoting ubiquitination and subsequent proteasomal degradation of FLT3, a receptor tyrosine kinase associated with cell proliferation and differentiation. Through these ubiquitination events, UBE2L6 contributes to the targeted degradation of specific proteins, influencing cellular pathways and processes, particularly those related to cell cycle control and signaling cascades.

Actividad biológica

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

O14933 (M1-S153)

Gene ID
Molecular Construction
N-term
UBE2L6 (M1-S153)
Accession # O14933
6*His
C-term
Protein Length

Full Length

Synonyms
Ubiquitin/ISG15-Conjugating Enzyme E2 L6; Retinoic Acid-Induced Gene B Protein; RIG-B; UbcH8; Ubiquitin Carrier Protein L6; Ubiquitin-Protein Ligase L6; UBE2L6; UBCH8
AA Sequence

MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS

Predicted Molecular Mass
18.8 kDa
Peso molecular

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Pureza

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM HEPES, 100 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Envío

Shipping with dry ice.

Documentación
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

UBE2L6 Protein, Human (His)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
UBE2L6 Protein, Human (His)
Cat. No.:
HY-P71020
Cantidad:
MCE Japan Authorized Agent: