UBE2L6 Protein, Human (His)
Based on 1 Customer Validation
The UBE2L6 protein plays a key role in cell regulation by catalyzing the covalent attachment of ubiquitin or ISG15 to other proteins. Notably, it plays a role in E6/E6-AP-induced ubiquitination of p53/TP53, a core process in regulating cellular responses to stress and DNA damage. UBE2L6 Protein, Human (His) is the recombinant human-derived UBE2L6 protein, expressed by E. coli , with C-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The UBE2L6 protein plays a key role in cell regulation by catalyzing the covalent attachment of ubiquitin or ISG15 to other proteins. Notably, it plays a role in E6/E6-AP-induced ubiquitination of p53/TP53, a core process in regulating cellular responses to stress and DNA damage. UBE2L6 Protein, Human (His) is the recombinant human-derived UBE2L6 protein, expressed by E. coli , with C-6*His labeled tag.
UBE2L6, also known as ubiquitin-conjugating enzyme E2L6, is a protein that catalyzes the covalent attachment of ubiquitin or ISG15 to other proteins, a process crucial for the regulation of protein stability and function. Specifically, UBE2L6 plays a role in the E6/E6-AP-induced ubiquitination of p53/TP53, a tumor suppressor protein involved in cell cycle regulation and apoptosis. Additionally, UBE2L6 is implicated in promoting ubiquitination and subsequent proteasomal degradation of FLT3, a receptor tyrosine kinase associated with cell proliferation and differentiation. Through these ubiquitination events, UBE2L6 contributes to the targeted degradation of specific proteins, influencing cellular pathways and processes, particularly those related to cell cycle control and signaling cascades.
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
O14933 (M1-S153)
-
Molecular Construction
-
N-term
-
UBE2L6 (M1-S153)
Accession # O14933 -
6*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
UBE2L6; Ubiquitin Conjugating Enzyme E2 L6; UBCH8; Ubiquitin/ISG15‑Conjugating Enzyme E2 L6; E2 Ubiquitin‑Conjugating Enzyme L6; Ubiquitin Carrier Protein L6; Ubiquitin‑Protein Ligase L6; RIG‑B; Retinoic Acid Induced Gene B Protein; Retinoic Acid‑Induced
-
AA Sequence
MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS
-
Predicted Molecular Mass
18.8 kDa
-
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 50 mM HEPES, 100 mM NaCl, pH 8.0.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
