UBE2M Protein, Human

UBE2M Protein is a crucial mediator in the ubiquitin-like protein NEDD8 conjugation pathway. It accepts NEDD8 from the UBA3-NAE1 E1 complex, covalently attaching it to target proteins like CUL1, CUL2, CUL3, and CUL4, particularly interacting with the E3 ubiquitin ligase RBX1. This specificity in neddylating specific targets suggests a pivotal role in regulating cellular processes, notably contributing to cell proliferation. UBE2M Protein, Human is the recombinant human-derived UBE2M protein, expressed by E. coli, with tag free. The total length of UBE2M Protein, Human is 183 a.a., with molecular weight of ~25.0 kDa.

UBE2M protein operates as an essential mediator in the ubiquitin-like protein NEDD8 conjugation pathway, accepting NEDD8 from the UBA3-NAE1 E1 complex and catalyzing its covalent attachment to various target proteins. The distinct interaction with the E3 ubiquitin ligase RBX1, as opposed to RBX2, underscores its specificity in neddylating particular targets, including CUL1, CUL2, CUL3, and CUL4. This specific neddylating activity suggests a pivotal role in regulating cellular processes, particularly contributing to cell proliferation.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

Tag Free

P61081 (M1-K183)

9040  [NCBI]

MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK

Approximately 25.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 50 mM HEPES, 2 mM DTT, 150 mM NaCl, 10% Glycerol, pH 7.5.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.