UBE2S Protein, Human (GST)

The UBE2S protein is critical in cellular ubiquitination, accepting ubiquitin from the E1 complex and catalyzing covalent attachment to various proteins.UBE2S is a key contributor to cell cycle regulation, catalyzing "Lys-11"-linked polyubiquitination, which is critical for anaphase-promoting complex/cyclosome (APC/C) function.UBE2S Protein, Human (GST) is the recombinant human-derived UBE2S protein, expressed by E.coli , with N-GST labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The UBE2S protein is critical in cellular ubiquitination, accepting ubiquitin from the E1 complex and catalyzing covalent attachment to various proteins.UBE2S is a key contributor to cell cycle regulation, catalyzing "Lys-11"-linked polyubiquitination, which is critical for anaphase-promoting complex/cyclosome (APC/C) function.UBE2S Protein, Human (GST) is the recombinant human-derived UBE2S protein, expressed by E.coli , with N-GST labeled tag.

Background

UBE2S, a pivotal player in cellular ubiquitination processes, accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to various proteins. A key contributor to cell cycle regulation, UBE2S catalyzes 'Lys-11'-linked polyubiquitination, particularly as an essential factor of the anaphase promoting complex/cyclosome (APC/C). In this context, UBE2S plays a crucial role in mitotic progression by specifically elongating 'Lys-11'-linked polyubiquitin chains initiated by the E2 enzyme UBE2C/UBCH10 on APC/C substrates, leading to enhanced degradation of these substrates by the proteasome and facilitating mitotic exit. Additionally, UBE2S is implicated in the ubiquitination and subsequent degradation of VHL, resulting in the accumulation of HIF1A. In vitro studies reveal UBE2S's ability to promote polyubiquitination using all seven ubiquitin Lys residues, except for 'Lys-48'-linked polyubiquitination, underscoring its versatility in ubiquitin chain formation.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-GST
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • GST
    • UBE2S (M1-L222)
      Accession # Q16763
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    UBE2S; Ubiquitin Conjugating Enzyme E2 S; E2-EPF; Ubiquitin-Conjugating Enzyme E2-24 KDa; Ubiquitin-Conjugating Enzyme E2-EPF5; Ubiquitin-Conjugating Enzyme E2 S; E2 Ubiquitin-Conjugating Enzyme S; Ubiquitin Carrier Protein S; Ubiquitin-Protein Ligase S;

  • AA Sequence

    MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMKLLLGKDFPASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLENYEEYAARARLLTEIHGGAGGPSGRAEAGRALASGTEASSTDPGAPGGPGGAEGPMAKKHAGERDKKLAAKKKTDKKRALRRL

  • Predicted Molecular Mass

    50.1 kDa

  • Molecular Weight

    Approximately 50 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00