UBE2S Protein, Human (GST)
The UBE2S protein is critical in cellular ubiquitination, accepting ubiquitin from the E1 complex and catalyzing covalent attachment to various proteins.UBE2S is a key contributor to cell cycle regulation, catalyzing "Lys-11"-linked polyubiquitination, which is critical for anaphase-promoting complex/cyclosome (APC/C) function.UBE2S Protein, Human (GST) is the recombinant human-derived UBE2S protein, expressed by E.coli , with N-GST labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The UBE2S protein is critical in cellular ubiquitination, accepting ubiquitin from the E1 complex and catalyzing covalent attachment to various proteins.UBE2S is a key contributor to cell cycle regulation, catalyzing "Lys-11"-linked polyubiquitination, which is critical for anaphase-promoting complex/cyclosome (APC/C) function.UBE2S Protein, Human (GST) is the recombinant human-derived UBE2S protein, expressed by E.coli , with N-GST labeled tag.
Background
UBE2S, a pivotal player in cellular ubiquitination processes, accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to various proteins. A key contributor to cell cycle regulation, UBE2S catalyzes 'Lys-11'-linked polyubiquitination, particularly as an essential factor of the anaphase promoting complex/cyclosome (APC/C). In this context, UBE2S plays a crucial role in mitotic progression by specifically elongating 'Lys-11'-linked polyubiquitin chains initiated by the E2 enzyme UBE2C/UBCH10 on APC/C substrates, leading to enhanced degradation of these substrates by the proteasome and facilitating mitotic exit. Additionally, UBE2S is implicated in the ubiquitination and subsequent degradation of VHL, resulting in the accumulation of HIF1A. In vitro studies reveal UBE2S's ability to promote polyubiquitination using all seven ubiquitin Lys residues, except for 'Lys-48'-linked polyubiquitination, underscoring its versatility in ubiquitin chain formation.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-GST
-
Accession
Q16763 (M1-L222)
-
Molecular Construction
-
N-term
-
GST
-
UBE2S (M1-L222)
Accession # Q16763 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
UBE2S; Ubiquitin Conjugating Enzyme E2 S; E2-EPF; Ubiquitin-Conjugating Enzyme E2-24 KDa; Ubiquitin-Conjugating Enzyme E2-EPF5; Ubiquitin-Conjugating Enzyme E2 S; E2 Ubiquitin-Conjugating Enzyme S; Ubiquitin Carrier Protein S; Ubiquitin-Protein Ligase S;
-
AA Sequence
MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMKLLLGKDFPASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLENYEEYAARARLLTEIHGGAGGPSGRAEAGRALASGTEASSTDPGAPGGPGGAEGPMAKKHAGERDKKLAAKKKTDKKRALRRL
-
Predicted Molecular Mass
50.1 kDa
-
Molecular Weight
Approximately 50 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)