1. Recombinant Proteins
  2. Ubiquitin Related Proteins
  3. Ubiquitin Enzymes
  4. E2 Enzymes
  5. Ubiquitin-Conjugating Enzyme E2 T
  6. UBE2T Protein, Human (His)

UBE2T Protein, Human (His)

Cat. No.: HY-P71409
Handling Instructions

UBE2T Protein, an essential ubiquitination component, serves as an E2 ubiquitin-conjugating enzyme, accepting ubiquitin from the E1 complex and catalyzing its covalent attachment to proteins. This multifaceted enzyme catalyzes monoubiquitination, crucial in MMC-induced DNA repair processes. Its significance is highlighted by specific association with the Fanconi anemia complex, collaborating with FANCL for FANCD2 monoubiquitination in the DNA damage response pathway. Beyond DNA repair, UBE2T mediates monoubiquitination of FANCL and FANCI and potentially contributes to BRCA1 ubiquitination and degradation. In vitro, UBE2T promotes various polyubiquitination types, showcasing involvement in diverse ubiquitin-dependent processes. UBE2T Protein, Human (His) is the recombinant human-derived UBE2T protein, expressed by E. coli, with N-6*His labeled tag. The total length of UBE2T Protein, Human (His) is 197 a.a., with molecular weight of 25-30 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

UBE2T Protein, an essential ubiquitination component, serves as an E2 ubiquitin-conjugating enzyme, accepting ubiquitin from the E1 complex and catalyzing its covalent attachment to proteins. This multifaceted enzyme catalyzes monoubiquitination, crucial in MMC-induced DNA repair processes. Its significance is highlighted by specific association with the Fanconi anemia complex, collaborating with FANCL for FANCD2 monoubiquitination in the DNA damage response pathway. Beyond DNA repair, UBE2T mediates monoubiquitination of FANCL and FANCI and potentially contributes to BRCA1 ubiquitination and degradation. In vitro, UBE2T promotes various polyubiquitination types, showcasing involvement in diverse ubiquitin-dependent processes. UBE2T Protein, Human (His) is the recombinant human-derived UBE2T protein, expressed by E. coli, with N-6*His labeled tag. The total length of UBE2T Protein, Human (His) is 197 a.a., with molecular weight of 25-30 kDa.

Background

UBE2T, an essential component of the ubiquitination machinery, serves as an E2 ubiquitin-conjugating enzyme that accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. This multifaceted enzyme demonstrates the ability to catalyze monoubiquitination, playing a crucial role in mitomycin-C (MMC)-induced DNA repair processes. UBE2T's significance is underscored by its specific association with the Fanconi anemia complex, where it collaborates with the E3 ubiquitin-protein ligase FANCL to catalyze monoubiquitination of FANCD2—an integral step in the DNA damage response pathway. Beyond its role in DNA repair, UBE2T exhibits versatility by mediating monoubiquitination of FANCL and FANCI and potentially contributing to the ubiquitination and degradation of BRCA1. Moreover, in vitro studies reveal UBE2T's capacity to promote various types of polyubiquitination, showcasing its involvement in diverse ubiquitin-dependent processes.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q9NPD8 (M1-V197)

Gene ID
Molecular Construction
N-term
6*His
UBE2T (M1-V197)
Accession # Q9NPD8
C-term
Synonyms
Ubiquitin-Conjugating Enzyme E2 T; Cell Proliferation-Inducing Gene 50 Protein; Ubiquitin Carrier Protein T; Ubiquitin-Protein Ligase T; UBE2T
AA Sequence

MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV

Molecular Weight

25-30 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
UBE2T Protein, Human (His)
Cat. No.:
HY-P71409
Quantity:
MCE Japan Authorized Agent: