UBE2T Protein, Human (His)
Based on 1 Customer Validation
UBE2T protein is an important ubiquitination component. As an E2 ubiquitin-conjugating enzyme, it accepts ubiquitin in the E1 complex and catalyzes its covalent attachment to proteins. This multifaceted enzyme catalyzes monoubiquitination, which is critical during MMC-induced DNA repair. UBE2T Protein, Human (His) is the recombinant human-derived UBE2T protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
UBE2T protein is an important ubiquitination component. As an E2 ubiquitin-conjugating enzyme, it accepts ubiquitin in the E1 complex and catalyzes its covalent attachment to proteins. This multifaceted enzyme catalyzes monoubiquitination, which is critical during MMC-induced DNA repair. UBE2T Protein, Human (His) is the recombinant human-derived UBE2T protein, expressed by E. coli , with N-6*His labeled tag.
UBE2T, an essential component of the ubiquitination machinery, serves as an E2 ubiquitin-conjugating enzyme that accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. This multifaceted enzyme demonstrates the ability to catalyze monoubiquitination, playing a crucial role in mitomycin-C (MMC)-induced DNA repair processes. UBE2T's significance is underscored by its specific association with the Fanconi anemia complex, where it collaborates with the E3 ubiquitin-protein ligase FANCL to catalyze monoubiquitination of FANCD2—an integral step in the DNA damage response pathway. Beyond its role in DNA repair, UBE2T exhibits versatility by mediating monoubiquitination of FANCL and FANCI and potentially contributing to the ubiquitination and degradation of BRCA1. Moreover, in vitro studies reveal UBE2T's capacity to promote various types of polyubiquitination, showcasing its involvement in diverse ubiquitin-dependent processes.
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q9NPD8 (M1-V197)
-
Molecular Construction
-
N-term
-
6*His
-
UBE2T (M1-V197)
Accession # Q9NPD8 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
UBE2T; Ubiquitin Conjugating Enzyme E2 T; Ubiquitin‑Conjugating Enzyme E2 T; E2 Ubiquitin‑Conjugating Enzyme T; Ubiquitin Carrier Protein T; Ubiquitin‑Protein Ligase T; HSPC150; FANCT; Cell Proliferation‑Inducing Gene 50 Protein; Ubiquitin‑Conjugating Enz
-
AA Sequence
MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV
-
Predicted Molecular Mass
24.7 kDa
-
Molecular Weight
Approximately 25-30 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 50 mM HEPES, 150 mM NaCl, 2 mM DTT, 10% glycerol, pH 7.5.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
