UBE2W Protein, Human (His)

Customer Review

Based on 1 Customer Validation

UBE2W protein is a multifunctional ubiquitin-conjugating enzyme that accepts ubiquitin in the E1 complex and catalyzes its covalent attachment to different substrates. Notably, UBE2W uniquely monoubiquitylates the N-terminus, including ATXN3, MAPT/TAU, POLR2H/RPB8, and STUB1/CHIP, showing specificity for disordered N-termini. UBE2W Protein, Human (His) is the recombinant human-derived UBE2W protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

UBE2W protein is a multifunctional ubiquitin-conjugating enzyme that accepts ubiquitin in the E1 complex and catalyzes its covalent attachment to different substrates. Notably, UBE2W uniquely monoubiquitylates the N-terminus, including ATXN3, MAPT/TAU, POLR2H/RPB8, and STUB1/CHIP, showing specificity for disordered N-termini. UBE2W Protein, Human (His) is the recombinant human-derived UBE2W protein, expressed by E. coli , with N-His labeled tag.

Background

UBE2W, a versatile ubiquitin-conjugating enzyme, fulfills a crucial role in cellular processes by accepting ubiquitin from the E1 complex and catalyzing its covalent attachment to diverse substrates (PubMed:20061386, PubMed:21229326). Notably, UBE2W exhibits a unique ability to monoubiquitinate the N-terminus of various substrates, including ATXN3, MAPT/TAU, POLR2H/RPB8, and STUB1/CHIP, showcasing its specificity for disordered N-termini (PubMed:23560854, PubMed:23696636, PubMed:25436519). This monoubiquitination process plays a critical role in the degradation of misfolded chaperone substrates, as UBE2W mediates the monoubiquitination of STUB1/CHIP, leading to the recruitment of ATXN3 and restriction of the ubiquitin chain length attached to STUB1/CHIP substrates (PubMed:23696636, PubMed:25436519). Moreover, UBE2W, particularly activated by UV irradiation, acts as a specific E2 ubiquitin-conjugating enzyme for the Fanconi anemia complex, collaborating with E3 ubiquitin-protein ligase FANCL to catalyze monoubiquitination of FANCD2, a crucial step in the DNA damage response pathway (PubMed:19111657, PubMed:21229326). In addition to its versatile monoubiquitination capabilities, UBE2W can catalyze 'Lys-11'-linked polyubiquitination in vitro, demonstrating its flexibility in ubiquitin chain formation (PubMed:25436519).

Verified Bioactivity

Under ATP and E1 conditions, UBE2W binds with ubiquitin molecules to form thioester complexes UBE2W-Ub.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • UBE2W (M1-C151)
      Accession # Q96B02-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    UBE2W; Ubiquitin Conjugating Enzyme E2 W; N-Terminal E2 Ubiquitin-Conjugating Enzyme; E2 Ubiquitin-Conjugating Enzyme W; Ubiquitin Carrier Protein W; Ubiquitin-Protein Ligase W; N-Terminus-Conjugating E2; UBC-16; Ubiquitin-Conjugating Enzyme E2 W; Ubiquit

  • AA Sequence

    MASMQKRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQVMFTGENIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCKEKRRPPDNSFYVRTCNKNPKKTKWWYHDDTC

  • Predicted Molecular Mass

    17.3 kDa

  • Molecular Weight

    Approximately 18kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00