1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. VEGF & VEGFR
  4. VEGF
  5. VEGF-C
  6. VEGF-C Protein, Mouse/Rat (HEK293, Fc)

VEGF-C protein stimulates cell proliferation, migration, and vascular permeability, which are critical for angiogenesis and endothelial cell dynamics. It plays a crucial role in the development of the venous and lymphatic vasculature during embryogenesis and in the maintenance of adult lymphatic endothelium. VEGF-C Protein, Mouse/Rat (HEK293, Fc) is the recombinant rat, mouse-derived VEGF-C protein, expressed by HEK293 , with N-hFc labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
50 μg 해외재고보유
100 μg 견적 받기
> 100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

VEGF-C protein stimulates cell proliferation, migration, and vascular permeability, which are critical for angiogenesis and endothelial cell dynamics. It plays a crucial role in the development of the venous and lymphatic vasculature during embryogenesis and in the maintenance of adult lymphatic endothelium. VEGF-C Protein, Mouse/Rat (HEK293, Fc) is the recombinant rat, mouse-derived VEGF-C protein, expressed by HEK293 , with N-hFc labeled tag.

Background

VEGF-CC, a growth factor crucial in angiogenesis and endothelial cell dynamics, exerts stimulatory effects on cellular proliferation and migration, while also influencing the permeability of blood vessels. It plays a vital role in angiogenesis, particularly in the development of the venous and lymphatic vascular systems during embryogenesis. Additionally, VEGF-CC contributes to the maintenance of differentiated lymphatic endothelium in adults. The protein binds and activates the KDR/VEGFR2 and FLT4/VEGFR3 receptors, orchestrating essential signaling pathways for vascular development and homeostasis. Structurally, VEGF-CC forms a homodimer with a non-covalent and antiparallel arrangement. Its interaction with FLT4/VEGFR3 is imperative for FLT4/VEGFR3 homodimerization and subsequent activation, highlighting the intricacies of its regulatory role in vascular processes.

Biological Activity

1.Immobilized mouse FLT4-His at 10 μg/mL (100 μL/well) can bind mouse/rat Fc-VEGFC and the EC50 is 0.41-0.95 μg/mL.
2.Measured in a cell proliferation assay using human umbilical vein endothelial cells (HUVEC) and the ED50 is typically 70-300 ng/mL

Species

Rat; Mouse

Source

HEK293

Tag

N-hFc

Accession

P97953 (A108-R223)/O35757(A108-R223)

Gene ID

22341  [NCBI]/114111

Molecular Construction
N-term
hFc
VEGF-CC (A108-R223)/O35757(A108-R223)
Accession # P97953
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Flt4-L; vascular endothelial growth factor C; VEGFC; VRP
AA Sequence

AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR

Predicted Molecular Mass
41.5 kDa
분자량

Approximately 44 kDa & 34 kDa, based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

VEGF-C Protein, Mouse/Rat (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

VEGF-C Protein, Mouse/Rat (HEK293, Fc)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
VEGF-C Protein, Mouse/Rat (HEK293, Fc)
Cat. No.:
HY-P74475
수량:
MCE Japan Authorized Agent: