1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. VEGF & VEGFR
  4. VEGF
  5. VEGF-A
  6. VEGF120 Protein, Mouse

VEGF120 Protein, Mouse

Cat. No.: HY-P72775
COA Handling Instructions

VEGF-A Protein is a key member of the VEGF family of cytokines. VEGF-A participates in angiogenesis, vasculogenesis, and endothelial cell growth, inducing endothelial cell proliferation, promoting cell migration, inhibiting cell apoptosis, and inducing vascular permeability. VEGF-A stimulates endothelial cell mitogenesis and cell migration. VEGF120 Protein, Mouse is the recombinant mouse-derived VEGF120 protein, expressed by E. coli, with tag free. The total length of VEGF120 Protein, Mouse is 120 a.a., with homodimer molecular weight of ~28.4 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $135 In-stock
50 μg $378 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

VEGF-A Protein is a key member of the VEGF family of cytokines. VEGF-A participates in angiogenesis, vasculogenesis, and endothelial cell growth, inducing endothelial cell proliferation, promoting cell migration, inhibiting cell apoptosis, and inducing vascular permeability. VEGF-A stimulates endothelial cell mitogenesis and cell migration. VEGF120 Protein, Mouse is the recombinant mouse-derived VEGF120 protein, expressed by E. coli, with tag free. The total length of VEGF120 Protein, Mouse is 120 a.a., with homodimer molecular weight of ~28.4 kDa.

Background

VEGF-A is a key member of the VEGF family of cytokines, along with VEGF-B, -C, -D, and PGF. VEGF-A participates in angiogenesis, vasculogenesis, and endothelial cell growth, inducing endothelial cell proliferation, promoting cell migration, inhibiting cell apoptosis, and inducing vascular permeability. VEGF-A binds to the FLT1/VEGFR1, KDR/VEGFR2 and DEAR/FBXW7-AS1 receptors, heparan sulfate and heparin. VEGF-A also binds to NRP1 initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development. VEGF-A stimulates endothelial cell mitogenesis and cell migration. VEGF-A is also a vasodilator and increases microvascular permeability[1][2][3][4][5].

Biological Activity

The cell proliferation assay using human umbilical vein endothelial cells has an ED50 value of less than 5 ng/ml; corresponding to a specific activity of > 2.0 × 105 IU/mg.

Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

Q00731-3 (A27-R146)

Gene ID

22339  [NCBI]

Molecular Construction
N-term
VEGF120 (A27-R146)
Accession # Q00731-3
C-term
Synonyms
VEGF-AA; Vascular endothelial growth factor A; VPF; VEGFA
AA Sequence

APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKCDKPRR

Molecular Weight

Approximately 28.4 kDa (Disulfide-linked homodimer)

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg; determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

VEGF120 Protein, Mouse Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
VEGF120 Protein, Mouse
Cat. No.:
HY-P72775
Quantity:
MCE Japan Authorized Agent: