VEGF121 Protein, Human (120 a.a)

VEGF121 Protein, Human (120 a.a), a VEGF isoform splice variant, cannot bind to heparin. VEGF121 Protein is predictor for survival in activated B-cell-like diffuse large B-cell lymphoma and is related to an immune response gene signature conserved in cancers.

VEGF-121 lacks heparin binding ability and requires cell-surface heparan sulfates for efficient binding to the VEGF receptors of human melanoma cells^[1]. In addition, VEGF-121 and VEGF 165 regulate blood vessel diameter through vascular endothelial growth factor receptor 2 in an in vitro angiogenesis model. VEGF-121 is predictor for survival in activated B-cell-like diffuse large B-cell lymphoma and is related to an immune response gene signature conserved in cancers^[2][3]. Furthermore, VEGF-121 plasma level is biomarker for response to anti-angiogenetic therapy in recurrent glioblastoma^[4].

1. The ED₅₀ is ≤7.548 ng/mL as measured by HUVEC cells, corresponding to a specific activity of ≥1.32 × 10⁵ units/mg.
2. Immobilized Human VEGF 121 at 2 μg/mL (100 μl/well) can bind Human VEGFR2-Fc.The ED₅₀ of Human VEGFR2-Fc is ≤78 ng/mL.
3. Loaded Zifibancimig (HY-P990689) on FAB2G biosensor, can bind VEGF121 Protein, Human (120 a.a) with an affinity constant of <1.000E-11 M as determined in BLI assay.

• 
  Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED₅₀ for this effect is 7.474 ng/mL, corresponding to a specific activity is 1.34×10⁵ units/mg.
• 
  Loaded Zifibancimig (HY-P990689) on FAB2G biosensor, can bind VEGF121 Protein, Human (120 a.a) with an affinity constant of <1.000E-11 M as determined in BLI assay.

Human

E. coli

Tag Free

P15692-9 (P28-R147)

7422  [NCBI]

Partial

PMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR

Approximately 14-28 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. /biology-dictionary/ht-1080-cell.html  [Content Brief]

  [2]. Cohen T, et al. VEGF121, a vascular endothelial growth factor (VEGF) isoform lacking heparin binding ability, requires cell-surface heparan sulfates for efficient binding to the VEGF receptors of human melanoma cells. J Biol Chem. 1995 May 12;270(19):11322-6.  [Content Brief]

  [3]. Broséus J, et al. VEGF121, is predictor for survival in activated B-cell-like diffuse large B-cell lymphoma and is related to an immune response gene signature conserved in cancers. Oncotarget. 2017 Jul 19;8(53):90808-90824.  [Content Brief]

  [4]. Nakatsu MN, et al. VEGF(121) and VEGF(165) regulate blood vessel diameter through vascular endothelial growth factor receptor 2 in an in vitro angiogenesis model. Lab Invest. 2003 Dec;83(12):1873-85.  [Content Brief]

  [5]. Martini M, et al. VEGF-121 plasma level as biomarker for response to anti-angiogenetic therapy in recurrent glioblastoma. BMC Cancer. 2018 May 10;18(1):553.  [Content Brief]