VEGF121 Protein, Human (HEK293)
Based on 1 Customer Validation
VEGF121 Protein is a subtype of Vascular Endothelial Growth Factor A (VEGF-A). VEGF-A is a key member of the VEGF family of cytokines that can promote neovascularization and increase vascular permeability. VEGF121 Protein, Human (HEK293) is the recombinant human-derived VEGF121 protein, expressed by HEK293 , with tag free. The total length of VEGF121 Protein, Human (HEK293) is 147 a.a., with molecular weight of ~19.9 & 17.0 kDa, respectively.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
VEGF121 Protein is a subtype of Vascular Endothelial Growth Factor A (VEGF-A). VEGF-A is a key member of the VEGF family of cytokines that can promote neovascularization and increase vascular permeability. VEGF121 Protein, Human (HEK293) is the recombinant human-derived VEGF121 protein, expressed by HEK293 , with tag free. The total length of VEGF121 Protein, Human (HEK293) is 147 a.a., with molecular weight of ~19.9 & 17.0 kDa, respectively.
Background
VEGF121 is a subtype of Vascular Endothelial Growth Factor A (VEGF-A). VEGF-A is a growth factor active in angiogenesis, vasculogenesis, and endothelial cell growth. VEGF-A induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis, and induces permeabilization of blood vessels. VEGF-A binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, as well as heparan sulfate and heparin. It also binds to the NRP1/neuropilin-1 receptor. When VEGF-A binds to NRP1, it initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development. Additionally, VEGF-A binds to the DEAR/FBXW7-AS1 receptor.
Verified Bioactivity
1.Immobilized human VEGF121 at 2μg/mL (100μL/well) can bind human VEGFR2-Fc and the EC50 is 5-50 ng/mL.
2.Measured in a cell proliferation assay using human umbilical vein endothelial cells (HUVEC) and the ED50 is typically 3-15 ng/mL.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag Tag Free
-
Accession
P15692-9 (A27-R147)
-
Molecular Construction
-
N-term
-
VEGF121 (A27-R147)
Accession # P15692-9 -
C-term
-
-
Protein Length
Full Length of Isoform-9
-
Synonyms
VEGFA; Vascular Endothelial Growth Factor A; VEGF; VPF; Vascular Permeability Factor; Vascular Endothelial Growth Factor A, Long Form; VEGF-A; L-VEGF; Vascular Endothelial Growth Factor A121; Vascular Endothelial Growth Factor A165; Vascular Endothelial G
-
AA Sequence
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR
-
Predicted Molecular Mass
14 kDa
-
Molecular Weight
Approximately 20 kDa & 17 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (263 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Vempati P, et al. Extracellular regulation of VEGF: isoforms, proteolysis, and vascular patterning. Cytokine Growth Factor Rev. 2014 Feb;25(1):1-19. [Content Brief]
[2]. Murphy JF, et al. Vascular endothelial growth factor induces cyclooxygenase-dependent proliferation of endothelial cells via the VEGF-2 receptor. FASEB J. 2001 Jul;15(9):1667-9. [Content Brief]
[3]. Dixelius J, et al. Minimal active domain and mechanism of action of the angiogenesis inhibitor histidine-rich glycoprotein. Cancer Res. 2006 Feb 15;66(4):2089-97. [Content Brief]
[4]. Glorioso N, et al. Association of ATP1A1 and dear single-nucleotide polymorphism haplotypes with essential hypertension: sex-specific and haplotype-specific effects. Circ Res. 2007 May 25;100(10):1522-9. [Content Brief]
[5]. Khayati F, et al. EMMPRIN/CD147 is a novel coreceptor of VEGFR-2 mediating its activation by VEGF. Oncotarget. 2015;6(12):9766-80. [Content Brief]
[7]. Ferrara N, et al. Molecular and biological properties of the vascular endothelial growth factor family of proteins. Endocr Rev. 1992 Feb;13(1):18-32. [Content Brief]
[8]. Terman BI, et al. Identification of the KDR tyrosine kinase as a receptor for vascular endothelial cell growth factor. Biochem Biophys Res Commun. 1992 Sep 30;187(3):1579-86. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
