Copy Link Print Information

KGF-2/FGF-10 Protein, Human (169a.a)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

KGF-2/FGF-10 belongs to the fibroblast growth factor family and is a heparin-binding protein secreted by mesenchymal cells. KGF-2/FGF-10 regulates epithelial cell function by binding to the FGFR2-IIIb/FGFR1-IIIb receptors of epithelial cells. KGF-2/FGF-10 can be used in the study of tissue repair and prevention of fibrosis in diseases such as lung injury and corneal alkali burns. KGF-2/FGF-10 Protein, Human (169a.a) is the recombinant human-derived KGF-2/FGF-10 protein, expressed by E.coli, with tag-free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for KGF-2/FGF-10 Protein, Human (169a.a)
  • Experimental Validation Results for KGF-2/FGF-10 Protein, Human (169a.a)
  • KGF-2/FGF-10 Protein, Human (169a.a) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

KGF-2/FGF-10 belongs to the fibroblast growth factor family and is a heparin-binding protein secreted by mesenchymal cells. KGF-2/FGF-10 regulates epithelial cell function by binding to the FGFR2-IIIb/FGFR1-IIIb receptors of epithelial cells. KGF-2/FGF-10 can be used in the study of tissue repair and prevention of fibrosis in diseases such as lung injury and corneal alkali burns[2][3]. KGF-2/FGF-10 Protein, Human (169a.a) is the recombinant human-derived KGF-2/FGF-10 protein, expressed by E.coli, with tag-free.

Background

KGF-2/FGF-10 (keratinocyte growth factor-2) belongs to the fibroblast growth factor family (FGF family) and is a 20 kD heparin-binding protein secreted by mesenchymal cells. KGF-2/FGF-10 mainly acts on epithelial cells, and its receptors are FGFR2-IIIb and FGFR1-IIIb (IIIb subtype of fibroblast growth factor receptor 2/1) expressed by epithelial cells. Its function is mainly mediated by the FGF-2 IIIb receptor, which is a transmembrane receptor expressed only by epithelial cells[1]. KGF-2 promotes the growth, proliferation and differentiation of epithelial cells and has a good effect in treating epithelial damage. KGF-2 can enhance corneal wound healing in a rabbit model of carbon dioxide laser-induced corneal injury. KGF-2/FGF-10 regulates epithelial cell proliferation, migration and differentiation by binding to FGFR2-IIIb/FGFR1-IIIb receptors, and participates in tissue repair and inflammation regulation. KGF-2/FGF-10 is induced by inflammatory factors (such as TNF-α and IL-1β) upstream, and promotes cell adhesion downstream through integrins (such as VLA-4)[2][3]. KGF-2/FGF-10 participates in AMPK, PI3K-mTOR, MAPK/ERK and p38 pathways. In the AMPK pathway, KGF-2/FGF-10 activates AMPK in lung injury, inhibits NLRP3 inflammasome and pyroptosis (GSDMD/IL-1β)[2]; in the PI3K-mTOR pathway, KGF-2/FGF-10 promotes alveolar type II cell autophagy (such as increased LC3II and decreased p62)[2]; in the MAPK/ERK and p38 pathways, KGF-2/FGF-10 activates ERK1/2 and p38 in corneal repair, promotes fibroblast migration, and inhibits TGF-β1-induced α-SMA expression and myofibroblast differentiation[3].
KGF-2/FGF-10 can be used in the research of lung diseases, corneal repair, and the prevention and treatment of tissue fibrosis. In the ventilator-induced lung injury (VILI) model, KGF-2/FGF-10 alleviates pulmonary edema by protecting the alveolar-capillary barrier, reducing the release of inflammatory factors (TNF-α, MIP-2), and increasing the expression of surfactant proteins (SP-A/B/C)[2]. KGF-2/FGF-10 accelerates epithelial healing and inhibited scar formation (reduced α-SMA and myofibroblasts) in the corneal alkali burn model, with a better effect than bFGF[3]. KGF-2/FGF-10 also inhibits the differentiation of myofibroblasts and reduces the expression of fibrosis-related proteins[3].

In Vitro

In the proliferation assay of rabbit corneal fibroblasts (RCFs), KGF-2/FGF-10 (human; 50 mg/mL; 48 h) promotes cell proliferation in a dose-dependent manner, and its effect could be blocked by the ERK1/2 inhibitor PD98059[3].
In the RCF scratch migration assay, KGF-2/FGF-10 (human; 50 mg/mL; 24 h) significantly promotes cell migration, with a stronger effect than bFGF, and the migration is dependent on the p38 and ERK1/2 signaling pathways. The p38 inhibitor SB203580 or the ERK1/2 inhibitor PD98059 could partially inhibit this effect[3].
KGF-2/FGF-10 (human; 50 mg/mL) significantly inhibits α-SMA expression and myofibroblast differentiation in TGF-β1-induced RCF differentiation experiments, and the effect is better than bFGF[3].

In Vivo

KGF-2/FGF-10 (human; 5 mg/kg; 72 h after administration, intratracheal instillation; single dose) significantly improves pulmonary edema, reduces the levels of inflammatory factors (TNF-α, MIP-2) in bronchoalveolar lavage fluid, increases the number of alveolar type II cells and the mRNA expression of lung surfactant proteins (SP-A, SP-B, SP-C), and alleviates lung tissue pathological damage in the rat ventilator-induced lung injury (VILI) model[3].
KGF-2/FGF-10 (human; 50 mg/mL; topical eye drops; 3 times/day; 14 days) accelerates corneal epithelial healing (wound closure within 7 days), reduces α-SMA expression and myofibroblast differentiation, and reduces corneal thickness and scar formation in the rat corneal alkali burn model, with better effects than bFGF[3].

Verified Bioactivity

Measured in a cell proliferation assay using 4MBr-5 rhesus monkey epithelial cells. The ED50 for this effect is ≤84.07 ng/mL, corresponding to a specificactivity is ≥1.2×104 Unit/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using 4MBr-5 rhesus monkey epithelial cells. The ED50 for this effect is 35.64 ng/mL, corresponding to a specificactivity is 2.806×104 Unit/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    O15520 (L40-S208)

  • Gene ID
    2255  [NCBI]
  • Molecular Construction
    • N-term
    • FGF-10 (L40-S208)
      Accession # O15520
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    FGF10; Produced By Fibroblasts Of Urinary Bladder Lamina Propria; Fibroblast Growth Factor 10; Fibroblast Growth Factor; Keratinocyte Growth Factor 2; LADD3; FGF-10; FGF

  • AA Sequence

    LGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS

  • Predicted Molecular Mass

    19.1 kDa

  • Molecular Weight

    Approximately 19-22 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 10 mM Tris, 5% sucrose, 4% mannitol, 0.02% Tween 80, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
4.Lyophilized from a 0.22 μm filtered solution of PBS.
5.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose.
6.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Cai J, et al. Pharmacokinetics of topically applied recombinant human keratinocyte growth factor-2 in alkali-burned and intact rabbit eye. Exp Eye Res. 2015 Jul;136:93-9. [Content Brief]

[2]. Bi J, et al. Keratinocyte growth factor-2 intratracheal instillation significantly attenuates ventilator-induced lung injury in rats. J Cell Mol Med. 2014 Jun;18(6):1226-35. [Content Brief]

[3]. Cai J, et al. Comparative Analysis of KGF-2 and bFGF in Prevention of Excessive Wound Healing and Scar Formation in a Corneal Alkali Burn Model. Cornea. 2019 Nov;38(11):1430-1437. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using 4MBr-5 rhesus monkey epithelial cells. The ED50 for this effect is 35.64 ng/mL, corresponding to a specificactivity is 2.806×104 Unit/mg.

  • KGF-2/FGF-10 Protein, Human (169a.a) Product Image
    1/16
  • Experimental Validation Results for KGF-2/FGF-10 Protein, Human (169a.a)
  • Experimental Validation Results for KGF-2/FGF-10 Protein, Human (169a.a)
  • KGF-2/FGF-10 Protein, Human (169a.a) Product Image