1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. VEGFs & VEGFRs
  4. VEGFs
  5. VEGF165 Protein, Human (HEK293)

VEGF165 Protein, Human (HEK293)

Cat. No.: HY-P7110A
Handling Instructions

VEGF165 Protein, Human (HEK293) is a Vascular Endothelial Growth Factor A (VEGF-A) isoform. VEGF is a heparin-binding growth factor specific for vascular endothelial cells that is able to induce angiogenesis.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $190 In-stock
Estimated Time of Arrival: December 31
50 μg $460 In-stock
Estimated Time of Arrival: December 31
100 μg $780 Get quote
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE VEGF165 Protein, Human (HEK293)

VEGF165 Protein, Human (HEK293) Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Human

Source

HEK293

Tag

Tag Free

Accession

P15692

Gene ID

7422

Synonyms
rHuVEGF165; VPF; Folliculostellate cell-derived growth factor; Glioma-derived endothelial cell mitogen
AA Sequence

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Molecular Weight

20-26 kDa

Biological Activity
The ED50 is <5 ng/mL as measured by HUVEC cells.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Vascular Endothelial Growth Factor (VEGF) has multiple isoforms, created by alternative splicing or proteolytic cleavage, and characterized by different receptor-binding and matrix-binding properties. These isoforms are known to give rise to a spectrum of angiogenesis patterns marked by differences in branching, which has functional implications for tissues. VEGF-A is a key member of the VEGF family of cytokines, along with VEGF-B, -C, -D, and PlGF. VEGF-A mediates angiogenesis, the expansion of an existing vascular bed by sprouting of new blood vessels. The vegfa gene is translated into a number of splice isoforms, the most notable in humans being VEGF121, VEGF165, and VEGF189[1].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
VEGF165 Protein, Human (HEK293)
Cat. No.:
HY-P7110A
Quantity:
MCE Japan Authorized Agent: