Copy Link Print Information

VEGF165 Protein, Human (HEK293)

19 Cited Publications
Customer Review

Based on 19 publication(s) in Google Scholar

VEGF165 Protein, Human is a Vascular Endothelial Growth Factor A (VEGF-A) isoform. VEGF165 Protein is the growth factor that affects the angiogenesis, vasculogenesis and endothelial cell growth. VEGF165 Protein can binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin, and affects the motor neuron signaling pathway. VEGF165 Protein, Human (HEK293) is a human-derived VEGF165 Protein that can be expressed by HEK293.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for VEGF165 Protein, Human (HEK293)
  • Experimental Validation Results for VEGF165 Protein, Human (HEK293)
  • Experimental Validation Results for VEGF165 Protein, Human (HEK293)
  • Experimental Validation Results for VEGF165 Protein, Human (HEK293)
  • Experimental Validation Results for VEGF165 Protein, Human (HEK293)
  • Experimental Validation Results for VEGF165 Protein, Human (HEK293)
  • Experimental Validation Results for VEGF165 Protein, Human (HEK293)
  • VEGF165 Protein, Human (HEK293) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

VEGF165 Protein, Human is a Vascular Endothelial Growth Factor A (VEGF-A) isoform. VEGF165 Protein is the growth factor that affects the angiogenesis, vasculogenesis and endothelial cell growth. VEGF165 Protein can binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin, and affects the motor neuron signaling pathway. VEGF165 Protein, Human (HEK293) is a human-derived VEGF165 Protein that can be expressed by HEK293.

Background

Vascular Endothelial Growth Factor (VEGF) has multiple isoforms, created by alternative splicing or proteolytic cleavage, and characterized by different receptor-binding and matrix-binding properties. These isoforms are known to give rise to a spectrum of angiogenesis patterns marked by differences in branching, which has functional implications for tissues. VEGF-A is a key member of the VEGF family of cytokines, along with VEGF-B, -C, -D, and PlGF. VEGF-A mediates angiogenesis, the expansion of an existing vascular bed by sprouting of new blood vessels. The vegfa gene is translated into a number of splice isoforms, the most notable in humans being VEGF121, VEGF165, and VEGF189[1].

In Vitro

VEGF165 Protein, Human (50 ng/mL, 12-48 h) promotes the proliferation, migration, invasion and tube formation of HUVECs[2].

Verified Bioactivity

Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED50 this effect is <15 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED50 this effect is 2.538 ng/mL, corresponding to a specific activity is 3.94×105 units/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag Tag Free
  • Accession

    P15692-4 (A27-R191)

  • Gene ID
    7422  [NCBI]
  • Molecular Construction
    • N-term
    • VEGF165 (A27-R191)
      Accession # P15692-4
    • C-term
  • Protein Length

    Full Length of Isoform-4

  • Synonyms

    VEGFA; Vascular Endothelial Growth Factor A; VEGF; VPF; Vascular Permeability Factor; Vascular Endothelial Growth Factor A, Long Form; VEGF-A; L-VEGF; Vascular Endothelial Growth Factor A121; Vascular Endothelial Growth Factor A165; Vascular Endothelial G

  • AA Sequence

    APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

  • Predicted Molecular Mass

    19.2 kDa

  • Molecular Weight

    Approximately 18-24 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol, 0.01% Tween 80.
4.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
5.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 150 mM NaCl, pH 8, 5% trehalose, 5% mannitol, 0.01% Tween 80.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Vempati P, et al. Extracellular regulation of VEGF: isoforms, proteolysis, and vascular patterning. Cytokine Growth Factor Rev. 2014 Feb;25(1):1-19. [Content Brief]

[2]. Dan H, et al., CM082, a novel VEGF receptor tyrosine kinase inhibitor, can inhibit angiogenesis in vitro and in vivo. Microvasc Res. 2021 Jul;136:104146. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED50 this effect is 2.538 ng/mL, corresponding to a specific activity is 3.94×105 units/mg.

  • 1/16

    VEGF165 Protein, Human (HEK293) purchased from MedChemExpress. Usage Cited in: Adv Fiber Mater. 2025 Oct 20.

    Customer Validation
     Proliferation results of HUVECs on PGSCC/PLLA films chemically grafted with various concentrations of BSA (0.2, 0.6, 1.8, or 5.4 mg/mL) or VEGFA (100 or 200 ng/mL, 24 h) (n = 3).

  • 1/16

    VEGF165 Protein, Human (HEK293) purchased from MedChemExpress. Usage Cited in: Life Sci. 2025 Sep 15:377:123739. [Abstract]

    Customer Validation
     Representative images of immunofluorescence staining of VEGFR-Rab5 colocalization 15 or 60 min after stimulation with VEGF (100 ng/mL).

  • 1/16

    VEGF165 Protein, Human (HEK293) purchased from MedChemExpress. Usage Cited in: Bone Res. 2024 Apr 10;12(1):24. [Abstract]

    Customer Validation
     Quantitative PCR (qPCR) results illustrating gene expression levels of CD31 and EMCN, normalized to housekeeping gene GAPDH, in ligament cells treated with PBS (Vehicle) or 100 ng/ml VEGFA. Values indicate means ± s.d., n = 3. *P < 0.05, **P < 0.01 by Student's t-test.

  • 1/16

    VEGF165 Protein, Human (HEK293) purchased from MedChemExpress. Usage Cited in: Anal Chem. 2024 Apr 30;96(17):6692-6699. [Abstract]

    Customer Validation
     Specificity investigation of the polyA-mediated PHA. The concentration of VEGF-165 was 5 μg/mL. Error bars represent the SDs (n = 3).

  • 1/16

    VEGF165 Protein, Human (HEK293) purchased from MedChemExpress. Usage Cited in: Int J Mol Sci. 2024 May 20;25(10):5559. [Abstract]

    Customer Validation
     The conditioned media from RT4 (n=7) and T24 (n=11) cells transfected with siPSMB4 were collected. The angiogenesis factors of VEFG-121, VEGF-165, and VEGF-B (2 µg/mL) were added into the condition media. Tube formation was observed after 6 h.

  • VEGF165 Protein, Human (HEK293) Product Image
    1/16
  • Experimental Validation Results for VEGF165 Protein, Human (HEK293)
  • Experimental Validation Results for VEGF165 Protein, Human (HEK293)
  • Experimental Validation Results for VEGF165 Protein, Human (HEK293)
  • Experimental Validation Results for VEGF165 Protein, Human (HEK293)
  • Experimental Validation Results for VEGF165 Protein, Human (HEK293)
  • Experimental Validation Results for VEGF165 Protein, Human (HEK293)
  • Experimental Validation Results for VEGF165 Protein, Human (HEK293)
  • VEGF165 Protein, Human (HEK293) Product Image

  • VEGF165 Protein, Human (HEK293) purchased from MedChemExpress. Usage Cited in: Adv Fiber Mater. 2025 Oct 20.

    Proliferation results of HUVECs on PGSCC/PLLA films chemically grafted with various concentrations of BSA (0.2, 0.6, 1.8, or 5.4 mg/mL) or VEGFA (100 or 200 ng/mL, 24 h) (n = 3).

  • VEGF165 Protein, Human (HEK293) purchased from MedChemExpress. Usage Cited in: Life Sci. 2025 Sep 15:377:123739. [Abstract]

    Representative images of immunofluorescence staining of VEGFR-Rab5 colocalization 15 or 60 min after stimulation with VEGF (100 ng/mL).

  • VEGF165 Protein, Human (HEK293) purchased from MedChemExpress. Usage Cited in: Bone Res. 2024 Apr 10;12(1):24. [Abstract]

    Quantitative PCR (qPCR) results illustrating gene expression levels of CD31 and EMCN, normalized to housekeeping gene GAPDH, in ligament cells treated with PBS (Vehicle) or 100 ng/ml VEGFA. Values indicate means ± s.d., n = 3. *P < 0.05, **P < 0.01 by Student's t-test.

  • VEGF165 Protein, Human (HEK293) purchased from MedChemExpress. Usage Cited in: Anal Chem. 2024 Apr 30;96(17):6692-6699. [Abstract]

    Specificity investigation of the polyA-mediated PHA. The concentration of VEGF-165 was 5 μg/mL. Error bars represent the SDs (n = 3).

  • VEGF165 Protein, Human (HEK293) purchased from MedChemExpress. Usage Cited in: Int J Mol Sci. 2024 May 20;25(10):5559. [Abstract]

    The conditioned media from RT4 (n=7) and T24 (n=11) cells transfected with siPSMB4 were collected. The angiogenesis factors of VEFG-121, VEGF-165, and VEGF-B (2 µg/mL) were added into the condition media. Tube formation was observed after 6 h.