VEGF165 Protein, Human (HEK293)

VEGF165 Protein, Human is a Vascular Endothelial Growth Factor A (VEGF-A) isoform. VEGF165 Protein is the growth factor that affects the angiogenesis, vasculogenesis and endothelial cell growth. VEGF165 Protein can binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin, and affects the motor neuron signaling pathway. VEGF165 Protein, Human (HEK293) is a human-derived VEGF165 Protein that can be expressed by HEK293.

Vascular Endothelial Growth Factor (VEGF) has multiple isoforms, created by alternative splicing or proteolytic cleavage, and characterized by different receptor-binding and matrix-binding properties. These isoforms are known to give rise to a spectrum of angiogenesis patterns marked by differences in branching, which has functional implications for tissues. VEGF-A is a key member of the VEGF family of cytokines, along with VEGF-B, -C, -D, and PlGF. VEGF-A mediates angiogenesis, the expansion of an existing vascular bed by sprouting of new blood vessels. The vegfa gene is translated into a number of splice isoforms, the most notable in humans being VEGF121, VEGF165, and VEGF189^[1].

VEGF165 Protein, Human (50 ng/mL, 12-48 h) promotes the proliferation, migration, invasion and tube formation of HUVECs^[2].

Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED₅₀ this effect is <15 ng/mL.

• 
  Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED₅₀ this effect is 2.538 ng/mL, corresponding to a specific activity is 3.94×10⁵ units/mg.

Human

HEK293

Tag Free

P15692-4 (A27-R191)

7422  [NCBI]

Partial

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Approximately 18-24 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol, 0.01% Tween 80.
4.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
5.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 150 mM NaCl, pH 8, 5% trehalose, 5% mannitol, 0.01% Tween 80.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Vempati P, et al. Extracellular regulation of VEGF: isoforms, proteolysis, and vascular patterning. Cytokine Growth Factor Rev. 2014 Feb;25(1):1-19.  [Content Brief]

  [2]. Dan H, et al., CM082, a novel VEGF receptor tyrosine kinase inhibitor, can inhibit angiogenesis in vitro and in vivo. Microvasc Res. 2021 Jul;136:104146.  [Content Brief]