1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. EGF superfamily
  4. EGF
  5. EGF Protein, Human

EGF Protein, Human

Cat. No.: HY-P7109
Handling Instructions

EGF Protein, Human is a potent epidermal growth factor, stimulates the proliferation of epidermal cells and is used in wound healing applications.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
50 μg $50 In-stock
Estimated Time of Arrival: December 31
100 μg $70 Get quote
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

EGF Protein, Human Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Human

Source

E. coli

Accession

P01133 (N971-R1023)

Gene ID

1950

Synonyms
rHuEGF; Pro-epidermal growth factor; Urogastrone
AA Sequence

MNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

Molecular Weight

Approximately 6.2 kDa

Biological Activity
The ED50 is <0.2 ng/mL as measured by murine BALB/c 3T3 cells, corresponding to a specific activity of 5.0 × 106 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 10mM Phosphate buffer, pH 7.0, 200 mM NaCl buffer.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Recombinant Human Epidermal Growth Factor is chemically identical to the natural material, exhibits full biological activity and is ued in wound healing applications[1]. Recombinant Human Epidermal Growth Factor (rhEGF) stimulates proliferation of the fibroblast BALB/c3T3 cell line. Recombinant Human Epidermal Growth Factor released from hydrogels keeps its bioactivity, induces EGF receptor expression, causes proliferating cell nuclear antigen and shows therapeutic potential in enhancing diabetic wound healing[2].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EGF Protein, Human
Cat. No.:
HY-P7109
Quantity:
MCE Japan Authorized Agent: