1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. EGF Superfamily
  4. EGF
  5. EGF Protein, Human

EGF Protein, Human

Cat. No.: HY-P7109
COA Handling Instructions

EGF Protein, Human is a potent epidermal growth factor, stimulates the proliferation of epidermal cells and is used in wound healing applications.

For research use only. We do not sell to patients.

Size Price Stock Quantity
Free Sample   Apply now  
10 μg $35 In-stock
50 μg $50 In-stock
100 μg $70 In-stock
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

EGF Protein, Human is a potent epidermal growth factor, stimulates the proliferation of epidermal cells and is used in wound healing applications.

Background

Recombinant Human Epidermal Growth Factor is chemically identical to the natural material, exhibits full biological activity and is ued in wound healing applications[1]. Recombinant Human Epidermal Growth Factor (rhEGF) stimulates proliferation of the fibroblast BALB/c3T3 cell line. Recombinant Human Epidermal Growth Factor released from hydrogels keeps its bioactivity, induces EGF receptor expression, causes proliferating cell nuclear antigen and shows therapeutic potential in enhancing diabetic wound healing[2].

Biological Activity

1.The ED50, calculated by the dose-dependant proliferation of murine BALB/c 3T3 cells is less than 0.2 ng/mL, corresponding to a specific activity of 5 × 106 IU/ mg.
2.Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 60-450 pg/mL, corresponding to a specific activity is > 2.2×106 units/mg.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P01133 (N971-R1023)

Gene ID
Synonyms
rHuEGF; Pro-epidermal growth factor; Urogastrone
AA Sequence

NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

Molecular Weight

6-12 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 10 mM Phosphate buffer, pH 7.0, 200 mM NaCl buffer or 20 mM PB, 150 mM NaCl, pH 7.4 or 20 mM Tris, 200 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

EGF Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EGF Protein, Human
Cat. No.:
HY-P7109
Quantity:
MCE Japan Authorized Agent: