EGF Protein, Human

EGF Protein, Human is a potent epidermal growth factor, stimulates the proliferation of epidermal cells and is used in wound healing applications.

Recombinant Human Epidermal Growth Factor is chemically identical to the natural material, exhibits full biological activity and is ued in wound healing applications^[1]. Recombinant Human Epidermal Growth Factor (rhEGF) stimulates proliferation of the fibroblast BALB/c3T3 cell line. Recombinant Human Epidermal Growth Factor released from hydrogels keeps its bioactivity, induces EGF receptor expression, causes proliferating cell nuclear antigen and shows therapeutic potential in enhancing diabetic wound healing^[2].

Measured in a cell proliferation assay using BALB/c 3T3 cells. The ED₅₀ for this effect is <300 pg/mL.

• 
  Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells.The ED₅₀ for this effect is 279.4 pg/mL, corresponding to a specific activity is 3.5791×10⁶ units/mg.

Human

E. coli

Tag Free

P01133-1 (N971-R1023)

1950  [NCBI]

NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR

Approximately 7-10 kDa due to the glycosylation

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 10 mM Phosphate buffer, pH 7.0, 200 mM NaCl buffer or 20 mM PB, 150 mM NaCl, pH 7.4 or 20 mM Tris, 200 mM NaCl, pH 8.0 or 50 mM Tris-HCL, 200 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Wong WR, et al. Applications, and efficient large-scale production, of recombinant human epidermal growth factor. Biotechnol Genet Eng Rev. 2001;18:51-71.  [Content Brief]

  [2]. Lao G, et al. Controlled release of epidermal growth factor from hydrogels accelerates wound healing in diabetic rats. J Am Podiatr Med Assoc. 2012 Mar-Apr;102(2):89-98.  [Content Brief]