EGF Protein, Canine (His)
Based on 1 Customer Validation
The EGF protein plays a key role in promoting the growth of a variety of epidermal and epithelial tissues in vivo and in vitro and in stimulating the proliferation of certain fibroblasts in cell culture. In addition, it also has the effect of magnesium-stimulating hormone, causing magnesium reabsorption in the renal distal convoluted tubule through the participation of EGFR and the activation of magnesium channel TRPM6. EGF Protein, Canine (His) is the recombinant canine-derived EGF protein, expressed by E. coli , with N-His labeled tag.
- Species: Canine
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The EGF protein plays a key role in promoting the growth of a variety of epidermal and epithelial tissues in vivo and in vitro and in stimulating the proliferation of certain fibroblasts in cell culture. In addition, it also has the effect of magnesium-stimulating hormone, causing magnesium reabsorption in the renal distal convoluted tubule through the participation of EGFR and the activation of magnesium channel TRPM6. EGF Protein, Canine (His) is the recombinant canine-derived EGF protein, expressed by E. coli , with N-His labeled tag.
Epidermal Growth Factor (EGF) is a potent stimulator of growth for various epidermal and epithelial tissues both in vivo and in vitro, as well as some fibroblasts in cell culture. This multifunctional protein plays a vital role in cellular processes, particularly in promoting the proliferation and development of tissues. Beyond its role in tissue growth, EGF acts as a magnesiotropic hormone, facilitating magnesium reabsorption in the renal distal convoluted tubule through the engagement of EGFR and activation of the magnesium channel TRPM6. Additionally, EGF interacts with EGFR, promoting EGFR dimerization, and engages with RHBDF1 and RHBDF2, potentially influencing EGF's intracellular trafficking and degradation pathways. These interactions underline the complex and versatile functions of EGF in both growth and signaling processes within the cell.
Immobilized Canine EGF, His Tag at 1 μg/mL (100 μl/well) on the plate. Dose response curve for Human EGFR, hFc Tag with the EC50 of 4.7 ng/mL determined by ELISA.
Technical Parameters
-
Species Canine
-
Source E. coli
-
Tag N-His
-
Accession
Q9BEA0 (N973-R1024)
-
Molecular Construction
-
N-term
-
His
-
EGF (N973-R1024)
Accession # Q9BEA0 -
C-term
-
-
Protein Length
Partial
-
Synonyms
EGF; Alternative Protein EGF; Epidermal Growth Factor; Beta-Urogastrone; Pro-Epidermal Growth Factor; HOMG4; Epidermal Growth Factor (Beta-Urogastrone); URG
-
AA Sequence
NGYRECPSSYDGYCLYNGVCMYIEAVDRYACNCVFGYVGERCQHRDLKWELR
-
Predicted Molecular Mass
13.6 kDa
-
Molecular Weight
Approximately 16-22 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE or Bis-Tris PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
