Copy Link Print Information

EGF Protein, Rat

4 Cited Publications
Customer Review

Based on 4 publication(s) in Google Scholar

EGF Protein, Rat is a potent epidermal growth factor, promotes epithelial proliferation and migration, and increases epithelial wound closure and shortens healing time.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for EGF Protein, Rat
  • Experimental Validation Results for EGF Protein, Rat
  • Experimental Validation Results for EGF Protein, Rat
  • Experimental Validation Results for EGF Protein, Rat
  • Experimental Validation Results for EGF Protein, Rat
  • Experimental Validation Results for EGF Protein, Rat
  • Experimental Validation Results for EGF Protein, Rat
  • EGF Protein, Rat Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

EGF Protein, Rat is a potent epidermal growth factor, promotes epithelial proliferation and migration, and increases epithelial wound closure and shortens healing time.

Background

Epidermal Growth Factor is secreted by epithelial cells, promotes epithelial proliferation and migration in a variety of tissues, and increases epithelial wound closure and shortens healing time[1]. Epidermal Growth Factor plays a key role in skin development and homeostasis, shows a protective function in the epidermal barrier. Epidermal Growth Factor also displays an immunomodulatory activity in the inflamed skin tissue[2].

Verified Bioactivity

Measured in a cell proliferation assay using BALB/c 3T3 mouse fibroblasts. The ED50 for this effect is 30-90 pg/mL.

Technical Parameters

  • Species Rat
  • Source E. coli
  • Tag Tag Free
  • Accession

    P07522/NP_036974.1 (N974-R1026)

  • Gene ID
    25313  [NCBI]
  • Molecular Construction
    • N-term
    • EGF (N974-R1026)
      Accession # P07522
    • C-term
  • Protein Length

    Partial

  • Synonyms

    EGF; Alternative Protein EGF; Epidermal Growth Factor; Beta-Urogastrone; Pro-Epidermal Growth Factor; HOMG4; Epidermal Growth Factor (Beta-Urogastrone); URG

  • AA Sequence

    NSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWWKLR

  • Predicted Molecular Mass

    6.3 kDa

  • Molecular Weight

    Approximately 6-9 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol, 0.01% Tween 80.
4.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Palencia L, et al. Epidermal growth factor mediated healing in stem cell-derived vocal fold mucosa. J Surg Res. 2015 Jul;197(1):32-8. [Content Brief]

[2]. Choi SY, et al. Epidermal Growth Factor Relieves Inflammatory Signals in Staphylococcus aureus-Treated Human Epidermal Keratinocytes and Atopic Dermatitis-Like Skin Lesions in Nc/Nga Mice. Biomed Res Int. 2018 May 15;2018:9439182. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 this effect is 199.3 pg/mL, corresponding to a specific activity is 5.02×106 U/mg.

  • 1/16

    EGF Protein, Rat purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2026 May 1:176:116466. [Abstract]

    Customer Validation
     EGF Protein, Rat (100 ng/mL; 5 min) reversed the reduction in ERK1/2 phosphorylation in PC12 cells under ACY-738 treatment.

  • 1/16

    EGF Protein, Rat purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2026 May 1:176:116466. [Abstract]

    Customer Validation
     EGF Protein, Rat (100 ng/mL; 5 min) reversed the reduction in TNF-α and IL-1β mRNA expression levels in PC12 cells under ACY-738 treatment.

  • 1/16

    EGF Protein, Rat purchased from MedChemExpress. Usage Cited in: FASEB J. 2024 Feb 29;38(4):e23469. [Abstract]

    Customer Validation
     EGF Protein, Rat (2.5 μg/mL; 200 μL; i.p.) significantly upregulated Fshβ mRNA expression in adenopituitary tissues of Sprague-Dawley rats.

  • 1/16

    EGF Protein, Rat purchased from MedChemExpress. Usage Cited in: FASEB J. 2024 Feb 29;38(4):e23469. [Abstract]

    Customer Validation
     EGF Protein, Rat (2.5 μg/mL; 200 μL; i.p.) significantly increased FSH content within the serum of Sprague-Dawley rats.

  • 1/16

    EGF Protein, Rat purchased from MedChemExpress. Usage Cited in: FASEB J. 2024 Feb 29;38(4):e23469. [Abstract]

    Customer Validation
     EGF Protein, Rat (2.5 μg/mL; 200 μL; i.p.) significantly upregulated FSHB protein expression in adenopituitary tissues and adenopituitary progenitor cells of Sprague-Dawley rats.

  • EGF Protein, Rat Product Image
    1/16
  • Experimental Validation Results for EGF Protein, Rat
  • Experimental Validation Results for EGF Protein, Rat
  • Experimental Validation Results for EGF Protein, Rat
  • Experimental Validation Results for EGF Protein, Rat
  • Experimental Validation Results for EGF Protein, Rat
  • Experimental Validation Results for EGF Protein, Rat
  • Experimental Validation Results for EGF Protein, Rat
  • EGF Protein, Rat Product Image