Copy Link Print Information

EGF Protein, Mouse (His)

3 Cited Publications
Customer Review

Based on 3 publication(s) in Google Scholar

EGF is a polypeptide. EGF is originally isolated and purified from the submandibular gland of adult male mice. EGF binds to the epidermal growth factor receptor (EGFR) on the cell surface and activates a series of signal transduction pathways such as the c-Src/STAT3 signaling pathway, thereby stimulating cell proliferation. EGF has activities such as inducing cell morphological changes and activating protein kinases. EGF Protein, Mouse (His) is a recombinant EGF protein expressed by E. coli with a C-6*His tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for EGF Protein, Mouse (His)
  • Experimental Validation Results for EGF Protein, Mouse (His)
  • EGF Protein, Mouse (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

EGF is a polypeptide. EGF is originally isolated and purified from the submandibular gland of adult male mice. EGF binds to the epidermal growth factor receptor (EGFR) on the cell surface and activates a series of signal transduction pathways such as the c-Src/STAT3 signaling pathway, thereby stimulating cell proliferation. EGF has activities such as inducing cell morphological changes and activating protein kinases. EGF Protein, Mouse (His) is a recombinant EGF protein expressed by E. coli with a C-6*His tag.

Background

EGF Protein belongs to the epidermal growth factor family. EGF is a polypeptide that was originally isolated and purified from the submandibular gland of adult male mice[1]. EGF binds to the epidermal growth factor receptor (EGFR) on the cell surface and activates a series of signal transduction pathways such as the c-Src/STAT3 signaling pathway, thereby stimulating cell proliferation[1]. EGF has activities such as inducing cell morphological changes and activating protein kinases[5]. EGF is expressed in a variety of tissues, including testis, breast, ovary, etc[1][2][4]. Mouse EGF is highly similar to EGF from other species such as human in terms of amino acid sequence[5]. Mouse EGF is a single-chain polypeptide with 53 amino acid residues and a molecular weight of approximately 6045 Da[5].

Verified Bioactivity

Measured by its ability to inhibits the proliferation of human epithelial A431 cells. The ED50 for this effect is 2-20 ng/mL.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag C-6*His
  • Accession

    P01132 (N977-R1029)

  • Gene ID
    13645  [NCBI]
  • Molecular Construction
    • N-term
    • EGF (N977-R1029)
      Accession # P01132
    • 6*His
    • C-term
  • Protein Length

    Full Length of EGF

  • Synonyms

    EGF; Alternative Protein EGF; Epidermal Growth Factor; Beta-Urogastrone; Pro-Epidermal Growth Factor; HOMG4; Epidermal Growth Factor (Beta-Urogastrone); URG

  • AA Sequence

    NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR

  • Predicted Molecular Mass

    7.2 kDa

  • Molecular Weight

    Approximately 9-14 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Chen JX, et al. Involvement of c-Src/STAT3 signal in EGF-induced proliferation of rat spermatogonial stem cells. Mol Cell Biochem. 2011 Dec;358(1-2):67-73. [Content Brief]

[2]. Guo Y, et al. Correlations among ERCC1, XPB, UBE2I, EGF, TAL2 and ILF3 revealed by gene signatures of histological subtypes of patients with epithelial ovarian cancer. Oncol Rep. 2012 Jan;27(1):286-92. [Content Brief]

[3]. Kim S, et al. Smad7 acts as a negative regulator of the epidermal growth factor (EGF) signaling pathway in breast cancer cells. Cancer Lett. 2012 Jan 28;314(2):147-54. [Content Brief]

[4]. Chatterton RT Jr, et al. Breast ductal lavage for assessment of breast cancer biomarkers. Horm Cancer. 2010 Aug;1(4):197-204. [Content Brief]

[5]. Schlessinger J, et al. Regulation of cell proliferation by epidermal growth factor. CRC Crit Rev Biochem. 1983;14(2):93-111. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    EGF Protein, Mouse (His) purchased from MedChemExpress. Usage Cited in: Sci Rep. 2025 Feb 19;15(1):6081. [Abstract]

    Customer Validation
     The protein levels of EGFR, p-EGFR, AKT, p-AKT, AMPK, and p-AMPK were measured via western blotting in H446 and H446/DDP cells treated with metformin (10 mM), EGF (50 µg/ml), or metformin + EGF for 48 h.

  • 1/16

    EGF Protein, Mouse (His) purchased from MedChemExpress. Usage Cited in: Cell Rep. 2023 Jun 24;42(7):112697. [Abstract]

    Customer Validation
     We used EGF (10 μM), the agonist of Erk1/2, and found that Erk1/2 and PPARγ were activated, while pioglitazone, the agonist of PPARγ, did not affect the expression of Erk1/2.

  • EGF Protein, Mouse (His) Product Image
    1/16
  • Experimental Validation Results for EGF Protein, Mouse (His)
  • Experimental Validation Results for EGF Protein, Mouse (His)
  • EGF Protein, Mouse (His) Product Image

  • EGF Protein, Mouse (His) purchased from MedChemExpress. Usage Cited in: Sci Rep. 2025 Feb 19;15(1):6081. [Abstract]

    The protein levels of EGFR, p-EGFR, AKT, p-AKT, AMPK, and p-AMPK were measured via western blotting in H446 and H446/DDP cells treated with metformin (10 mM), EGF (50 µg/ml), or metformin + EGF for 48 h.

  • EGF Protein, Mouse (His) purchased from MedChemExpress. Usage Cited in: Cell Rep. 2023 Jun 24;42(7):112697. [Abstract]

    We used EGF (10 μM), the agonist of Erk1/2, and found that Erk1/2 and PPARγ were activated, while pioglitazone, the agonist of PPARγ, did not affect the expression of Erk1/2.