EGF Protein, Mouse (His)

EGF is a polypeptide. EGF is originally isolated and purified from the submandibular gland of adult male mice. EGF binds to the epidermal growth factor receptor (EGFR) on the cell surface and activates a series of signal transduction pathways such as the c-Src/STAT3 signaling pathway, thereby stimulating cell proliferation. EGF has activities such as inducing cell morphological changes and activating protein kinases. EGF Protein, Mouse (His) is a recombinant EGF protein expressed by E. coli with a C-6*His tag.

EGF Protein belongs to the epidermal growth factor family. EGF is a polypeptide that was originally isolated and purified from the submandibular gland of adult male mice^[1]. EGF binds to the epidermal growth factor receptor (EGFR) on the cell surface and activates a series of signal transduction pathways such as the c-Src/STAT3 signaling pathway, thereby stimulating cell proliferation^[1]. EGF has activities such as inducing cell morphological changes and activating protein kinases^[5]. EGF is expressed in a variety of tissues, including testis, breast, ovary, etc^[1][2][4]. Mouse EGF is highly similar to EGF from other species such as human in terms of amino acid sequence^[5]. Mouse EGF is a single-chain polypeptide with 53 amino acid residues and a molecular weight of approximately 6045 Da^[5].

Measured by its ability to inhibits the proliferation of human epithelial A431 cells. The ED₅₀ for this effect is 2-20 ng/mL.

Mouse

E. coli

C-6*His

P01132 (N977-R1029)

13645  [NCBI]

Full Length of EGF

NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR

9-14 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Chen JX, et al. Involvement of c-Src/STAT3 signal in EGF-induced proliferation of rat spermatogonial stem cells. Mol Cell Biochem. 2011 Dec;358(1-2):67-73.  [Content Brief]

  [2]. Guo Y, et al. Correlations among ERCC1, XPB, UBE2I, EGF, TAL2 and ILF3 revealed by gene signatures of histological subtypes of patients with epithelial ovarian cancer. Oncol Rep. 2012 Jan;27(1):286-92.  [Content Brief]

  [3]. Kim S, et al. Smad7 acts as a negative regulator of the epidermal growth factor (EGF) signaling pathway in breast cancer cells. Cancer Lett. 2012 Jan 28;314(2):147-54.  [Content Brief]

  [4]. Chatterton RT Jr, et al. Breast ductal lavage for assessment of breast cancer biomarkers. Horm Cancer. 2010 Aug;1(4):197-204.  [Content Brief]

  [5]. Schlessinger J, et al. Regulation of cell proliferation by epidermal growth factor. CRC Crit Rev Biochem. 1983;14(2):93-111.  [Content Brief]