1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. EGF Superfamily
  4. EGF
  5. EGF Protein, Mouse (His)

EGF is a polypeptide. EGF is originally isolated and purified from the submandibular gland of adult male mice. EGF binds to the epidermal growth factor receptor (EGFR) on the cell surface and activates a series of signal transduction pathways such as the c-Src/STAT3 signaling pathway, thereby stimulating cell proliferation. EGF has activities such as inducing cell morphological changes and activating protein kinases. EGF Protein, Mouse (His) is a recombinant EGF protein expressed by E. coli with a C-6*His tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

    EGF Protein, Mouse (His) purchased from MCE. Usage Cited in: Sci Rep. 2025 Feb 19;15(1):6081.  [Abstract]

    The protein levels of EGFR, p-EGFR, AKT, p-AKT, AMPK, and p-AMPK were measured via western blotting in H446 and H446/DDP cells treated with metformin (10 mM), EGF (50 µg/ml), or metformin + EGF for 48 h.

    EGF Protein, Mouse (His) purchased from MCE. Usage Cited in: Cell Rep. 2023 Jun 24;42(7):112697.  [Abstract]

    We used EGF (10 μM), the agonist of Erk1/2, and found that Erk1/2 and PPARγ were activated, while pioglitazone, the agonist of PPARγ, did not affect the expression of Erk1/2.
    • Biological Activity

    • Technical Parameters

    • Properties

    • Documentation

    • References

    Description

    EGF is a polypeptide. EGF is originally isolated and purified from the submandibular gland of adult male mice. EGF binds to the epidermal growth factor receptor (EGFR) on the cell surface and activates a series of signal transduction pathways such as the c-Src/STAT3 signaling pathway, thereby stimulating cell proliferation. EGF has activities such as inducing cell morphological changes and activating protein kinases. EGF Protein, Mouse (His) is a recombinant EGF protein expressed by E. coli with a C-6*His tag.

    Background

    EGF Protein belongs to the epidermal growth factor family. EGF is a polypeptide that was originally isolated and purified from the submandibular gland of adult male mice[1]. EGF binds to the epidermal growth factor receptor (EGFR) on the cell surface and activates a series of signal transduction pathways such as the c-Src/STAT3 signaling pathway, thereby stimulating cell proliferation[1]. EGF has activities such as inducing cell morphological changes and activating protein kinases[5]. EGF is expressed in a variety of tissues, including testis, breast, ovary, etc[1][2][4]. Mouse EGF is highly similar to EGF from other species such as human in terms of amino acid sequence[5]. Mouse EGF is a single-chain polypeptide with 53 amino acid residues and a molecular weight of approximately 6045 Da[5].

    Biological Activity

    Measured by its ability to inhibits the proliferation of human epithelial A431 cells. The ED50 for this effect is 2-20 ng/mL.

    Species

    Mouse

    Source

    E. coli

    Tag

    C-6*His

    Accession

    P01132 (N977-R1029)

    Gene ID
    Molecular Construction
    N-term
    EGF (N977-R1029)
    Accession # P01132
    6*His
    C-term
    Protein Length

    Full Length of EGF

    Synonyms
    Pro-epidermal growth factor; Epidermal growth factor; EGF
    AA Sequence

    NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR

    Predicted Molecular Mass
    7.2 kDa
    Molecular Weight

    Approximately 9-14 kDa, based on SDS-PAGE under reducing conditions.

    Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

    Appearance

    Lyophilized powder.

    Formulation

    Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.
    Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

    Endotoxin Level

    <1 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    Shipping

    Room temperature in continental US; may vary elsewhere.

    Documentation
    References

    EGF Protein, Mouse (His) Related Classifications

    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    Your Recently Viewed Products:

    Inquiry Online

    Your information is safe with us. * Required Fields.

    EGF Protein, Mouse (His)

     

    Requested Quantity *

    Applicant Name *

     

    Salutation

    Email Address *

     

    Phone Number *

    Department

     

    Organization Name *

    City

    State

    Country or Region *

         

    Remarks

    Bulk Inquiry

    Inquiry Information

    Product Name:
    EGF Protein, Mouse (His)
    Cat. No.:
    HY-P70590
    Quantity:
    MCE Japan Authorized Agent: