EGF Protein, Mouse (HEK293)

EGF Protein, a growth factor, is essential for cell growth, proliferation, and differentiation. It binds to the EGF receptor, activating signaling pathways that regulate cell survival and tissue repair. EGF Protein has therapeutic potential in promoting wound healing, tissue regeneration, and cancer treatment. Its role in cellular processes makes it a subject of interest in biomedical research. EGF Protein, Mouse (HEK293) is the recombinant mouse-derived EGF protein, expressed by HEK293 , with tag free. The total length of EGF Protein, Mouse (HEK293) is 53 a.a., with molecular weight of ~7 kDa.

EGF is a potent growth factor that promotes the proliferation of various epidermal and epithelial tissues both in vivo and in vitro, as well as certain fibroblasts in cell culture. It acts as a magnesiotropic hormone by stimulating the reabsorption of magnesium in the renal distal convoluted tubule through the activation of EGFR and the magnesium channel TRPM6. EGF also interacts with EGFR, facilitating EGFR dimerization, and forms interactions with RHBDF1 and RHBDF2, potentially regulating its intracellular localization and degradation.

Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED₅₀ for this effect is 67.14 pg/mL, corresponding to a specific activity is 1.489×10⁷ units/mg.

• 
  Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells.The ED50 for this effect is 67.14 pg/mL, corresponding to a specific activity is 1.489×10⁷ units/mg.

Mouse

HEK293

Tag Free

P01132 (N977-R1029)

13645  [NCBI]

NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR

Approximately 7 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.