Copy Link Print Information

EGF Protein, Mouse (HEK293)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

EGF Protein, a growth factor, is essential for cell growth, proliferation, and differentiation. It binds to the EGF receptor, activating signaling pathways that regulate cell survival and tissue repair. EGF Protein has therapeutic potential in promoting wound healing, tissue regeneration, and cancer treatment. Its role in cellular processes makes it a subject of interest in biomedical research. EGF Protein, Mouse (HEK293) is the recombinant mouse-derived EGF protein, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for EGF Protein, Mouse (HEK293)
  • Experimental Validation Results for EGF Protein, Mouse (HEK293)
  • EGF Protein, Mouse (HEK293) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

EGF Protein, a growth factor, is essential for cell growth, proliferation, and differentiation. It binds to the EGF receptor, activating signaling pathways that regulate cell survival and tissue repair. EGF Protein has therapeutic potential in promoting wound healing, tissue regeneration, and cancer treatment. Its role in cellular processes makes it a subject of interest in biomedical research. EGF Protein, Mouse (HEK293) is the recombinant mouse-derived EGF protein, expressed by HEK293 , with tag free.

Background

EGF is a potent growth factor that promotes the proliferation of various epidermal and epithelial tissues both in vivo and in vitro, as well as certain fibroblasts in cell culture. It acts as a magnesiotropic hormone by stimulating the reabsorption of magnesium in the renal distal convoluted tubule through the activation of EGFR and the magnesium channel TRPM6. EGF also interacts with EGFR, facilitating EGFR dimerization, and forms interactions with RHBDF1 and RHBDF2, potentially regulating its intracellular localization and degradation.

Verified Bioactivity

Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 for this effect is <100 pg/mL, corresponding to a specific activity is ≤2.36×107 units/mg.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag Tag Free
  • Accession

    P01132 (N977-R1029)

  • Gene ID
    13645  [NCBI]
  • Molecular Construction
    • N-term
    • EGF (N977-R1029)
      Accession # P01132
    • C-term
  • Protein Length

    Full Length of EGF

  • Synonyms

    EGF; Alternative Protein EGF; Epidermal Growth Factor; Beta-Urogastrone; Pro-Epidermal Growth Factor; HOMG4; Epidermal Growth Factor (Beta-Urogastrone); URG

  • AA Sequence

    NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR

  • Predicted Molecular Mass

    6 kDa

  • Molecular Weight

    Approximately 11-14 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells.The ED50 for this effect is 67.14 pg/mL, corresponding to a specific activity is 1.489×107 units/mg.

  • EGF Protein, Mouse (HEK293) Product Image
    1/16
  • Experimental Validation Results for EGF Protein, Mouse (HEK293)
  • Experimental Validation Results for EGF Protein, Mouse (HEK293)
  • EGF Protein, Mouse (HEK293) Product Image