1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF Family
  4. Fibroblast Growth Factor
  5. FGF-2/bFGF
  6. FGF basic/bFGF Protein, Human (146a.a)

FGF-2 is a member of the fibroblast family involved in bone healing, cartilage repair, bone repair, and nerve regeneration. FGF-2 is also a mitotic promoter that accelerates cell proliferation. FGF-2 regulates immune processes by specifically targeting tyrosine kinase receptors and activating the FGF/FGFR signaling pathway. For example, FGF-2 is involved in the JAK-STAT signaling pathway to regulate cartilage metabolism and also activates ERK signaling to promote cartilage regeneration. FGF-2 combined with FGFR1/3 promoted degeneration and repair of articular cartilage, respectively. FGF-2 is also a known carcinogen in GBM, which contributes to glioma growth and vascularization.FGF basic/bFGF Protein, Human (146a.a), consists of 146 amino acids, produced by E.coli with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
250 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

38 Publications Citing Use of MCE FGF basic/bFGF Protein, Human (146a.a)

IF
Cell Imaging/Staining
WB
Flow Cytometry
RT-PCR

    FGF basic/bFGF Protein, Human (146a.a) purchased from MCE. Usage Cited in: Oncogene. 2025 Oct 11.  [Abstract]

    Representative images and quantification of the tumor sphere assay of the Par6-overexpressing or Par6-knockdown groups of U87MG-GSCs and T98G-GSCs. rh FGF basic (20 ng/mL).

    FGF basic/bFGF Protein, Human (146a.a) purchased from MCE. Usage Cited in: Cancer Commun (Lond). 2024 Apr;44(4):469-490.  [Abstract]

    Cells were seeded in ultra‐low attachment plates and cultured in serum‐free RPMI‐1640 supplemented with 2% B27 supplemen, 20 ng/mL EGF (MCE), and 10 ng/mL bFGF (MCE) in a humidified 5% CO2 at 37°C. Additionally, 25 µM ICG‐001 or 100 ng/mL Wnt3A (MCE) was added in the culture medium. After one‐week incubation, tumor sphere numbers were counted under a phase‐contrast microscope. The role of hnRNPA2B1 in maintenance of gastric cancer stemness was evaluated.

    FGF basic/bFGF Protein, Human (146a.a) purchased from MCE. Usage Cited in: Nat Commun. 2024 Jul 27;15(1):6344.  [Abstract]

    Western blotting images showing that FGF2 (20 ng/ml, 6 days) induced SST protein expression via FGFR1.

    FGF basic/bFGF Protein, Human (146a.a) purchased from MCE. Usage Cited in: Nat Commun. 2024 Jul 27;15(1):6344.  [Abstract]

    Representative flow cytometry results of cells with FGF7, FGF2 (20 ng/ml, 6 days), or FGF2/7 treatments demonstrating that the addition of FGF2 greatly increased the SST-positive fraction.

    FGF basic/bFGF Protein, Human (146a.a) purchased from MCE. Usage Cited in: Nat Commun. 2024 Jul 27;15(1):6344.  [Abstract]

    RT–qPCR of FGFR1, SST, and HHEX mRNA expression at completion of stage 5 after FGFR1 siRNA or scramble RNA treatment, with or without FGF2 treatments (20 ng/ml, 6 days).

    FGF basic/bFGF Protein, Human (146a.a) purchased from MCE. Usage Cited in: Cell Prolif. 2024 Jul 3:e13704.  [Abstract]

    Representative images of EdU assay in different drug therapy groups. bFGF slightly inhibited the expression of proinflammatory cytokines while significantly promoting cell proliferation in the DED model. NC: normal control, DED: dry eye disease, Diquas: 0.3% Diquafosol tetrasodium, CsA: 10 nM CsA, bFGF:100 ng/mL bFGF.

    FGF basic/bFGF Protein, Human (146a.a) purchased from MCE. Usage Cited in: Cell Prolif. 2024 Jul 3:e13704.  [Abstract]

    WB analysis and semiquantitative analysis of the expression of p-NFκB in the different groups. bFGF slightly inhibited the expression of proinflammatory cytokines while significantly promoting cell proliferation in the DED model. NC: normal control, DED: dry eye disease, Diquas: 0.3% Diquafosol tetrasodium, CsA: 10 nM CsA, bFGF:100 ng/mL bFGF.

    FGF basic/bFGF Protein, Human (146a.a) purchased from MCE. Usage Cited in: Fundam Res. 2022 Jun 3;4(6):1506-1514.  [Abstract]

    NEOs derived from mouse liver tissues are grown for 1 day and 14 days, using pipette deposition. rh FGF basic (10 ng/mL).
    • Biological Activity

    • Technical Parameters

    • Properties

    • Documentation

    • References

    Description

    FGF-2 is a member of the fibroblast family involved in bone healing, cartilage repair, bone repair, and nerve regeneration. FGF-2 is also a mitotic promoter that accelerates cell proliferation. FGF-2 regulates immune processes by specifically targeting tyrosine kinase receptors and activating the FGF/FGFR signaling pathway. For example, FGF-2 is involved in the JAK-STAT signaling pathway to regulate cartilage metabolism and also activates ERK signaling to promote cartilage regeneration. FGF-2 combined with FGFR1/3 promoted degeneration and repair of articular cartilage, respectively[1]. FGF-2 is also a known carcinogen in GBM, which contributes to glioma growth and vascularization[2].FGF basic/bFGF Protein, Human (146a.a), consists of 146 amino acids, produced by E.coli with tag free.

    Background

    FGF-2/bFGF is a member of the fibroblast family and has a high affinity for heparin. FGF-2 plays an important role in tendon to bone healing, cartilage repair, bone repair, and nerve regeneration. FGF-2 specifically binds to tyrosine kinase receptors and activates the FGF/FGFR signaling pathway. Subsequently, FGF-2 influences cell proliferation, differentiation and apoptosis, as well as immune regulation by transducing other classical pathways. For example, FGF-2 regulates the JAK-STAT signaling pathway to regulate cartilage metabolism. FGF-2 also acts as a mitotic promoter to accelerate cell proliferation. Therefore, (1) FGF-2 is an important growth factor in the healing process of ligament/tendon injury. In vitro experiments, low-dose FGF-2 can stimulate the proliferation and differentiation of bone marrow mesenchymal stem cells, and up-regulate the mRNA expression of type I/III collagen and fibronectin. However, high doses of FGF-2 did not stimulate extracellular matrix (ECM) protein proliferation and gene expression. (2) FGF-2 is also an endogenous and intrinsic growth factor in cartilage repair. FGF-2 binds to heparan sulfate proteoglycan and is stored in the ECM of articular cartilage. When cartilage is damaged or degenerated, ECM rapidly releases FGF-2 and activates ERK signaling pathways to promote cartilage regeneration. FGF-2 exhibits a biphasic effect in combination with its specific receptor. FGF-2 combined with FGFR3 promoted the repair of articular cartilage. FGF-2 combined with FGFR1 promoted the degeneration of articular cartilage[1]. FGF-2 is expressed in granulosa cells and colliculus cells, as well as hepatocellular cancer cells, but not in non-cancerous liver tissues. This reveals the role of FGF-2 in brain tumors, particularly glioblastoma. According to studies, FGF-2 is a known carcinogenic factor in GBM. FGF-2 increases the self-renewal of glioblastoma stem cells and contributes to the growth and vascularization of glioma[2]. FGF-2 protein is highly conserved in some species, and the similarity rate of human FGF-2 protein sequence to rat, mouse, and bovine was 97.4%, 95.45%, and 98.71%, respectively.

    In Vitro

    FGF-2 (human; 3 ng/mL, 30 ng/mL; 7-28 d) triggers the biphasic bone marrow stromal cell (BMSC) response at 3 ng/mL, promotes cell proliferation to peak on day 7, and significantly enhances mRNA expression of type I collagen, type III collagen, fibronectin, and alpha-smooth muscle actin on day 14 and 28. But there is no obvious effect at 30 ng/mL[3].

    Biological Activity

    The ED50 is <2 ng/mL as measured by 3T3 cells, corresponding to a specific activity of > 5.0 × 105 units/mg.

    • Measured in a cell proliferation assay using NIH-3T3 mouse embryonic fibroblasts. The ED50 for this effect is 0.3582 ng/mL, corresponding to a specific activity is 2.79×106 units/mg.
    Species

    Human

    Source

    E. coli

    Tag

    Tag Free

    Accession

    P09038-4 (P143-S288)

    Gene ID
    Molecular Construction
    N-term
    bFGF (P143-S288)
    Accession # P09038-4
    C-term
    Protein Length

    Full Length of Isoform-4 Mature Protein

    Synonyms
    rHubFGF; HBGF-2; FGF-2; FGF-b; FGF-basic
    AA Sequence

    PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

    Predicted Molecular Mass
    16.4 kDa
    Molecular Weight

    Approximately 14-20 kDa, based on SDS-PAGE under reducing conditions.

    Purity
    • ≥ 95%, as determined by reducing SDS-PAGE.
    Appearance

    Lyophilized powder

    Formulation

    1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4 .
    2.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 100 mM NaCl, 0.02% Tween 80, pH 7.5.
    3.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
    4.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
    5.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
    Please refer to the lot-specific COA for specific buffer information.
    Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

    Endotoxin Level

    <0.2 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    Shipping

    Room temperature in continental US; may vary elsewhere.

    Documentation
    References

    FGF basic/bFGF Protein, Human (146a.a) Related Classifications

    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    Your Recently Viewed Products:

    Inquiry Online

    Your information is safe with us. * Required Fields.

    FGF basic/bFGF Protein, Human (146a.a)

     

    Requested Quantity *

    Applicant Name *

     

    Salutation

    Email Address *

     

    Phone Number *

    Department

     

    Organization Name *

    City

    State

    Country or Region *

         

    Remarks

    Bulk Inquiry

    Inquiry Information

    Product Name:
    FGF basic/bFGF Protein, Human (146a.a)
    Cat. No.:
    HY-P7004
    Quantity:
    MCE Japan Authorized Agent: