Copy Link Print Information

FGF basic/bFGF Protein, Human (146a.a)

43 Cited Publications
Customer Review

Based on 43 publication(s) in Google Scholar

FGF-2 is a member of the fibroblast family involved in bone healing, cartilage repair, bone repair, and nerve regeneration. FGF-2 is also a mitotic promoter that accelerates cell proliferation. FGF-2 regulates immune processes by specifically targeting tyrosine kinase receptors and activating the FGF/FGFR signaling pathway. For example, FGF-2 is involved in the JAK-STAT signaling pathway to regulate cartilage metabolism and also activates ERK signaling to promote cartilage regeneration. FGF-2 combined with FGFR1/3 promoted degeneration and repair of articular cartilage, respectively. FGF-2 is also a known carcinogen in GBM, which contributes to glioma growth and vascularization.FGF basic/bFGF Protein, Human (146a.a), consists of 146 amino acids, produced by E.coli with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for FGF basic/bFGF Protein, Human (146a.a)
  • Experimental Validation Results for FGF basic/bFGF Protein, Human (146a.a)
  • Experimental Validation Results for FGF basic/bFGF Protein, Human (146a.a)
  • Experimental Validation Results for FGF basic/bFGF Protein, Human (146a.a)
  • Experimental Validation Results for FGF basic/bFGF Protein, Human (146a.a)
  • Experimental Validation Results for FGF basic/bFGF Protein, Human (146a.a)
  • Experimental Validation Results for FGF basic/bFGF Protein, Human (146a.a)
  • Experimental Validation Results for FGF basic/bFGF Protein, Human (146a.a)
  • Experimental Validation Results for FGF basic/bFGF Protein, Human (146a.a)
  • Experimental Validation Results for FGF basic/bFGF Protein, Human (146a.a)
  • FGF basic/bFGF Protein, Human (146a.a) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

FGF-2 is a member of the fibroblast family involved in bone healing, cartilage repair, bone repair, and nerve regeneration. FGF-2 is also a mitotic promoter that accelerates cell proliferation. FGF-2 regulates immune processes by specifically targeting tyrosine kinase receptors and activating the FGF/FGFR signaling pathway. For example, FGF-2 is involved in the JAK-STAT signaling pathway to regulate cartilage metabolism and also activates ERK signaling to promote cartilage regeneration. FGF-2 combined with FGFR1/3 promoted degeneration and repair of articular cartilage, respectively[1]. FGF-2 is also a known carcinogen in GBM, which contributes to glioma growth and vascularization[2].FGF basic/bFGF Protein, Human (146a.a), consists of 146 amino acids, produced by E.coli with tag free.

Background

FGF-2/bFGF is a member of the fibroblast family and has a high affinity for heparin. FGF-2 plays an important role in tendon to bone healing, cartilage repair, bone repair, and nerve regeneration. FGF-2 specifically binds to tyrosine kinase receptors and activates the FGF/FGFR signaling pathway. Subsequently, FGF-2 influences cell proliferation, differentiation and apoptosis, as well as immune regulation by transducing other classical pathways. For example, FGF-2 regulates the JAK-STAT signaling pathway to regulate cartilage metabolism. FGF-2 also acts as a mitotic promoter to accelerate cell proliferation. Therefore, (1) FGF-2 is an important growth factor in the healing process of ligament/tendon injury. In vitro experiments, low-dose FGF-2 can stimulate the proliferation and differentiation of bone marrow mesenchymal stem cells, and up-regulate the mRNA expression of type I/III collagen and fibronectin. However, high doses of FGF-2 did not stimulate extracellular matrix (ECM) protein proliferation and gene expression. (2) FGF-2 is also an endogenous and intrinsic growth factor in cartilage repair. FGF-2 binds to heparan sulfate proteoglycan and is stored in the ECM of articular cartilage. When cartilage is damaged or degenerated, ECM rapidly releases FGF-2 and activates ERK signaling pathways to promote cartilage regeneration. FGF-2 exhibits a biphasic effect in combination with its specific receptor. FGF-2 combined with FGFR3 promoted the repair of articular cartilage. FGF-2 combined with FGFR1 promoted the degeneration of articular cartilage[1]. FGF-2 is expressed in granulosa cells and colliculus cells, as well as hepatocellular cancer cells, but not in non-cancerous liver tissues. This reveals the role of FGF-2 in brain tumors, particularly glioblastoma. According to studies, FGF-2 is a known carcinogenic factor in GBM. FGF-2 increases the self-renewal of glioblastoma stem cells and contributes to the growth and vascularization of glioma[2]. FGF-2 protein is highly conserved in some species, and the similarity rate of human FGF-2 protein sequence to rat, mouse, and bovine was 97.4%, 95.45%, and 98.71%, respectively.

In Vitro

FGF-2 (human; 3 ng/mL, 30 ng/mL; 7-28 d) triggers the biphasic bone marrow stromal cell (BMSC) response at 3 ng/mL, promotes cell proliferation to peak on day 7, and significantly enhances mRNA expression of type I collagen, type III collagen, fibronectin, and alpha-smooth muscle actin on day 14 and 28. But there is no obvious effect at 30 ng/mL[3].

Verified Bioactivity

The ED50 is <2 ng/mL as measured by 3T3 cells, corresponding to a specific activity of > 5.0 × 105 units/mg.

Results
  • Experimental Validation Results for FGF basic/bFGF Protein, Human (146a.a)
    Measured in a cell proliferation assay using NIH-3T3 mouse embryonic fibroblasts. The ED50 for this effect is 0.3582 ng/mL, corresponding to a specific activity is 2.79×106 units/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    P09038-4 (P143-S288)

  • Gene ID
    2247  [NCBI]
  • Molecular Construction
    • N-term
    • bFGF (P143-S288)
      Accession # P09038-4
    • C-term
  • Protein Length

    Full Length of Isoform-4 Mature Protein

  • Synonyms

    rHubFGF; HBGF-2; FGF-2; FGF-b; FGF-basic

  • AA Sequence

    PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

  • Predicted Molecular Mass

    16.4 kDa

  • Molecular Weight

    Approximately 14-20 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

    • Experimental Validation Results for FGF basic/bFGF Protein, Human (146a.a)
      ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4 .
2.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 100 mM NaCl, 0.02% Tween 80, pH 7.5.
3.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
4.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
5.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Zhang J, et al. FGF2: a key regulator augmenting tendon-to-bone healing and cartilage repair. Regen Med. 2020 Sep;15(9):2129-2142. [Content Brief]

[2]. Westermann R, et al. Basic fibroblast growth factor (bFGF), a multifunctional growth factor for neuroectodermal cells. J Cell Sci Suppl. 1990;13:97-117. [Content Brief]

[3]. Jimenez-Pascual A, et al. FGF2: a novel druggable target for glioblastoma? Expert Opin Ther Targets. 2020 Apr;24(4):311-318. [Content Brief]

[4]. Rusnati M, et al. Interaction of angiogenic basic fibroblast growth factor with endothelial cell heparan sulfate proteoglycans. Biological implications in neovascularization. Int J Clin Lab Res. 1996;26(1):15-23. [Content Brief]

[5]. Hankemeier S, et al. Modulation of proliferation and differentiation of human bone marrow stromal cells by fibroblast growth factor 2: potential implications for tissue engineering of tendons and ligaments. Tissue Eng. 2005 Jan-Feb;11(1-2):41-9. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

  • ≥ 95%, as determined by reducing SDS-PAGE.

  • Measured in a cell proliferation assay using NIH-3T3 mouse embryonic fibroblasts. The ED50 for this effect is 0.3582 ng/mL, corresponding to a specific activity is 2.79×106 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using NIH-3T3 mouse embryonic fibroblasts. The ED50 for this effect is 0.3582 ng/mL, corresponding to a specific activity is 2.79×106 units/mg.

  • 1/16

    FGF basic/bFGF Protein, Human (146a.a) purchased from MedChemExpress. Usage Cited in: Oncogene. 2025 Oct 11. [Abstract]

    Customer Validation
     Representative images and quantification of the tumor sphere assay of the Par6-overexpressing or Par6-knockdown groups of U87MG-GSCs and T98G-GSCs. rh FGF basic (20 ng/mL).

  • 1/16

    FGF basic/bFGF Protein, Human (146a.a) purchased from MedChemExpress. Usage Cited in: Cancer Commun (Lond). 2024 Apr;44(4):469-490. [Abstract]

    Customer Validation
     Cells were seeded in ultra‐low attachment plates and cultured in serum‐free RPMI‐1640 supplemented with 2% B27 supplemen, 20 ng/mL EGF (MCE), and 10 ng/mL bFGF (MCE) in a humidified 5% CO2 at 37°C. Additionally, 25 µM ICG‐001 or 100 ng/mL Wnt3A (MCE) was added in the culture medium. After one‐week incubation, tumor sphere numbers were counted under a phase‐contrast microscope. The role of hnRNPA2B1 in maintenance of gastric cancer stemness was evaluated.

  • 1/16

    FGF basic/bFGF Protein, Human (146a.a) purchased from MedChemExpress. Usage Cited in: Nat Commun. 2024 Jul 27;15(1):6344. [Abstract]

    Customer Validation
     Western blotting images showing that FGF2 (20 ng/ml, 6 days) induced SST protein expression via FGFR1.

  • 1/16

    FGF basic/bFGF Protein, Human (146a.a) purchased from MedChemExpress. Usage Cited in: Nat Commun. 2024 Jul 27;15(1):6344. [Abstract]

    Customer Validation
     Representative flow cytometry results of cells with FGF7, FGF2 (20 ng/ml, 6 days), or FGF2/7 treatments demonstrating that the addition of FGF2 greatly increased the SST-positive fraction.

  • 1/16

    FGF basic/bFGF Protein, Human (146a.a) purchased from MedChemExpress. Usage Cited in: Nat Commun. 2024 Jul 27;15(1):6344. [Abstract]

    Customer Validation
     RT–qPCR of FGFR1, SST, and HHEX mRNA expression at completion of stage 5 after FGFR1 siRNA or scramble RNA treatment, with or without FGF2 treatments (20 ng/ml, 6 days).

  • 1/16

    FGF basic/bFGF Protein, Human (146a.a) purchased from MedChemExpress. Usage Cited in: Cell Prolif. 2024 Nov;57(11):e13704. [Abstract]

    Customer Validation
     Representative images of EdU assay in different drug therapy groups. bFGF slightly inhibited the expression of proinflammatory cytokines while significantly promoting cell proliferation in the DED model. NC: normal control, DED: dry eye disease, Diquas: 0.3% Diquafosol tetrasodium, CsA: 10 nM CsA, bFGF:100 ng/mL bFGF.

  • 1/16

    FGF basic/bFGF Protein, Human (146a.a) purchased from MedChemExpress. Usage Cited in: Cell Prolif. 2024 Nov;57(11):e13704. [Abstract]

    Customer Validation
     WB analysis and semiquantitative analysis of the expression of p-NFκB in the different groups. bFGF slightly inhibited the expression of proinflammatory cytokines while significantly promoting cell proliferation in the DED model. NC: normal control, DED: dry eye disease, Diquas: 0.3% Diquafosol tetrasodium, CsA: 10 nM CsA, bFGF:100 ng/mL bFGF.

  • 1/16

    FGF basic/bFGF Protein, Human (146a.a) purchased from MedChemExpress. Usage Cited in: Fundam Res. 2022 Jun 3;4(6):1506-1514. [Abstract]

    Customer Validation
     NEOs derived from mouse liver tissues are grown for 1 day and 14 days, using pipette deposition. rh FGF basic (10 ng/mL).

  • FGF basic/bFGF Protein, Human (146a.a) Product Image
    1/16
  • Experimental Validation Results for FGF basic/bFGF Protein, Human (146a.a)
  • Experimental Validation Results for FGF basic/bFGF Protein, Human (146a.a)
  • Experimental Validation Results for FGF basic/bFGF Protein, Human (146a.a)
  • Experimental Validation Results for FGF basic/bFGF Protein, Human (146a.a)
  • Experimental Validation Results for FGF basic/bFGF Protein, Human (146a.a)
  • Experimental Validation Results for FGF basic/bFGF Protein, Human (146a.a)
  • Experimental Validation Results for FGF basic/bFGF Protein, Human (146a.a)
  • Experimental Validation Results for FGF basic/bFGF Protein, Human (146a.a)
  • Experimental Validation Results for FGF basic/bFGF Protein, Human (146a.a)
  • Experimental Validation Results for FGF basic/bFGF Protein, Human (146a.a)
  • FGF basic/bFGF Protein, Human (146a.a) Product Image

  • FGF basic/bFGF Protein, Human (146a.a) purchased from MedChemExpress. Usage Cited in: Oncogene. 2025 Oct 11. [Abstract]

    Representative images and quantification of the tumor sphere assay of the Par6-overexpressing or Par6-knockdown groups of U87MG-GSCs and T98G-GSCs. rh FGF basic (20 ng/mL).

  • FGF basic/bFGF Protein, Human (146a.a) purchased from MedChemExpress. Usage Cited in: Cancer Commun (Lond). 2024 Apr;44(4):469-490. [Abstract]

    Cells were seeded in ultra‐low attachment plates and cultured in serum‐free RPMI‐1640 supplemented with 2% B27 supplemen, 20 ng/mL EGF (MCE), and 10 ng/mL bFGF (MCE) in a humidified 5% CO2 at 37°C. Additionally, 25 µM ICG‐001 or 100 ng/mL Wnt3A (MCE) was added in the culture medium. After one‐week incubation, tumor sphere numbers were counted under a phase‐contrast microscope. The role of hnRNPA2B1 in maintenance of gastric cancer stemness was evaluated.

  • FGF basic/bFGF Protein, Human (146a.a) purchased from MedChemExpress. Usage Cited in: Nat Commun. 2024 Jul 27;15(1):6344. [Abstract]

    Western blotting images showing that FGF2 (20 ng/ml, 6 days) induced SST protein expression via FGFR1.

  • FGF basic/bFGF Protein, Human (146a.a) purchased from MedChemExpress. Usage Cited in: Nat Commun. 2024 Jul 27;15(1):6344. [Abstract]

    Representative flow cytometry results of cells with FGF7, FGF2 (20 ng/ml, 6 days), or FGF2/7 treatments demonstrating that the addition of FGF2 greatly increased the SST-positive fraction.

  • FGF basic/bFGF Protein, Human (146a.a) purchased from MedChemExpress. Usage Cited in: Nat Commun. 2024 Jul 27;15(1):6344. [Abstract]

    RT–qPCR of FGFR1, SST, and HHEX mRNA expression at completion of stage 5 after FGFR1 siRNA or scramble RNA treatment, with or without FGF2 treatments (20 ng/ml, 6 days).

  • FGF basic/bFGF Protein, Human (146a.a) purchased from MedChemExpress. Usage Cited in: Cell Prolif. 2024 Nov;57(11):e13704. [Abstract]

    Representative images of EdU assay in different drug therapy groups. bFGF slightly inhibited the expression of proinflammatory cytokines while significantly promoting cell proliferation in the DED model. NC: normal control, DED: dry eye disease, Diquas: 0.3% Diquafosol tetrasodium, CsA: 10 nM CsA, bFGF:100 ng/mL bFGF.

  • FGF basic/bFGF Protein, Human (146a.a) purchased from MedChemExpress. Usage Cited in: Cell Prolif. 2024 Nov;57(11):e13704. [Abstract]

    WB analysis and semiquantitative analysis of the expression of p-NFκB in the different groups. bFGF slightly inhibited the expression of proinflammatory cytokines while significantly promoting cell proliferation in the DED model. NC: normal control, DED: dry eye disease, Diquas: 0.3% Diquafosol tetrasodium, CsA: 10 nM CsA, bFGF:100 ng/mL bFGF.

  • FGF basic/bFGF Protein, Human (146a.a) purchased from MedChemExpress. Usage Cited in: Fundam Res. 2022 Jun 3;4(6):1506-1514. [Abstract]

    NEOs derived from mouse liver tissues are grown for 1 day and 14 days, using pipette deposition. rh FGF basic (10 ng/mL).