1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF family
  4. FGF
  5. FGF basic/bFGF Protein, Human (154a.a)

FGF basic/bFGF Protein, Human (154a.a)

Cat. No.: HY-P7331
Handling Instructions

FGF basic/bFGF Protein, Human (154a.a) is a potent mitogen and chemoattractant for endothelial cells as well as fibroblasts, with 154 amino acid.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock
10 μg $110 Ask For Quote & Lead Time
50 μg $190 Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE FGF basic/bFGF Protein, Human (154a.a)

FGF basic/bFGF Protein, Human (154a.a) Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P09038 (A135-S288)

Gene ID

2247

Synonyms
rHubFGF, 154a.a.; bFGF; FGF-2; HBGF-2; FGFB
AA Sequence

AAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Molecular Weight

Approximately 17.1 kDa

Biological Activity
The ED50 is <0.25 ng/mL as measured by 3T3 cells, corresponding to a specific activity of >4 × 106 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Recombinant Human Basic Fibroblast Growth Factor is a potent mitogen and chemoattractant for endothelial cells as well as fibroblasts. Basic fibroblast growth factor (bFGF) is a heparin-binding mitogen for mesoderm-derived cells, also acts as a mitogen, differentiation inducing and maintenance factor for many neuroectodermal cells including glial cells, neurons, paraneurons, and their tumor counterparts. The molecule is expressed in several types of neuroectodermal cells. bFGF occurs in many neuronal target tissues, and can prevent ontogenetic as well as lesion-induced neuron death[1]. In vitro, basic fibroblast growth factor induces an angiogenic phenotype in endothelial cells, which includes chemotaxis, mitogenesis, protease production, beta-integrin expression, and tube formation in three-dimensional gels. It acts by binding to specific tyrosine kinase receptors and to cell-associated heparan sulfate proteoglycans[2].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGF basic/bFGF Protein, Human (154a.a)
Cat. No.:
HY-P7331
Quantity:
MCE Japan Authorized Agent: