Copy Link Print Information

BMP-4 Protein, Human

22 Cited Publications
Customer Review

Based on 22 publication(s) in Google Scholar

Bone morphogenetic protein 4 (BMP-4) is a polymorphic ligand protein belonging to the TGF-β family, which is involved in the circulation of the vascular system and can activate receptors on vascular cells. BMP-4 binds to type I receptors (ALK-2/-3/-6) and type II receptors (BMPR2, ACVR2A) to increase plaque formation and promote oxidative stress, endothelial dysfunction, and osteogenic differentiation through its pro-inflammatory and pro-atherogenic effects. BMP-4 Protein, Human has a total length of 116 amino acids (S293-R408), is expressed in E. coli cells with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for BMP-4 Protein, Human
  • Experimental Validation Results for BMP-4 Protein, Human
  • Experimental Validation Results for BMP-4 Protein, Human
  • Experimental Validation Results for BMP-4 Protein, Human
  • Experimental Validation Results for BMP-4 Protein, Human
  • Experimental Validation Results for BMP-4 Protein, Human
  • Experimental Validation Results for BMP-4 Protein, Human
  • BMP-4 Protein, Human Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Bone morphogenetic protein 4 (BMP-4) is a polymorphic ligand protein belonging to the TGF-β family, which is involved in the circulation of the vascular system and can activate receptors on vascular cells[1]. BMP-4 binds to type I receptors (ALK-2/-3/-6) and type II receptors (BMPR2, ACVR2A)[2] to increase plaque formation and promote oxidative stress, endothelial dysfunction, and osteogenic differentiation through its pro-inflammatory and pro-atherogenic effects[3]. BMP-4 Protein, Human has a total length of 116 amino acids (S293-R408), is expressed in E. coli cells with tag free.

Background

Bone Morphogenetic Protein 4 (BMP-4) is a ligand protein with pleiotropic, belongs to TGFβ family. BMP-4 involves in the vasculature circulation and can activate receptors on vascular cells[1].
BMP-4/TGFβ signaling can be terminated by inhibitory SMADs including SMAD6 and SMAD7, which are activated and induced by BMP signaling and switch off BMP signaling via multiple mechanisms[4].
BMP-4 is widely found in different animals, while the sequence in human is highly similar to Rat (96.81%), and mouse (97.54%).
BMP-4 is expressed by endothelial cells (ECs) in response to hypoxia and promotes vascular SMC proliferation. Therefore it inhibits the proliferation of smooth muscle cells (SMCs) isolated from the proximal pulmonary artery while induces proliferation of SMCs isolated from distal pulmonary arteries[5].
BMP-4 appears to be a marker and driver of vascular calcification, particularly in atherosclerosis[6].
BMP-4 induces angiogenesis, endothelial cells (ECs) proliferation, and migration[7].
BMP-4 is differentially expressed in calcified atherosclerotic plaques[8], serves as the linkers between atherosclerotic vascular calcification with mechanisms of normal bone formation[9].
BMP-4 increases plaque formation via their pro-inflammatory and pro-atherogenic effects, promoting oxidative stress, endothelial dysfunction and osteogenic differentiation[3].

In Vitro

BMP-4 (1 ng/mL for 4-5 d; 10 ng/mL for 3-4 d; 100 ng/mL for 2 d) induces a synchronous wave of differentiation occurred, characterized by flattened, enlarged cells with reduced proliferation[10].
BMP-4 (100 ng/mL; 7 d) initiates human embryonic stem cell differentiation to trophoblast[10].
BMP4 (10 or 100 ng/mL; 24 h) significantly increases the number of mesenchymal condensations by approximately 50%[11].

Verified Bioactivity

Measured by its ability to induce alkaline phosphatase production by ATDC5 mouse chondrogenic cells.The ED50 for this effect is < 60 ng/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    P12644 (S293-R408)

  • Gene ID
    652  [NCBI]
  • Molecular Construction
    • N-term
    • BMP-4 (S293-R408)
      Accession # P12644
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    BMP4; MCOPS6; Prev. BMP2B; OFC11; Bone Morphogenetic Protein 2B; BMP-4; Bone Morphogenetic Protein 4 Preproprotein; ZYME; Alternative Protein BMP4; DVR4; BMP2B1; Bone Morphogenetic Protein 4; BMP-2B

  • AA Sequence

    SPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR

  • Predicted Molecular Mass

    13.1 kDa

  • Molecular Weight

    Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 50 mM Na2CO3, 5 mM DTT, pH 11.0.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 200 mM NaCL, 500 mM arginine, pH 8.0.
3.Lyophilized from a 0.22 μm filtered solution of 0.1% TFA, 30% Acetonitrile, pH 2.5.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Yang P, et al. The role of bone morphogenetic protein signaling in vascular calcification. Bone. 2020 Dec;141:115542. [Content Brief]

[2]. Gieseler GM, et al. Solubilization and renaturation of biologically active human bone morphogenetic protein-4 from inclusion bodies. Biotechnol Rep (Amst). 2018 Apr 4;18:e00249. [Content Brief]

[3]. Miyazawa K, et al. Regulation of TGF-β Family Signaling by Inhibitory Smads. Cold Spring Harb Perspect Biol. 2017 Mar 1;9(3):a022095. [Content Brief]

[4]. Herrera B, et al. A rapid and sensitive bioassay for the simultaneous measurement of multiple bone morphogenetic proteins. Identification and quantification of BMP4, BMP6 and BMP9 in bovine and human serum. BMC Cell Biol. 2009 Mar 19;10:20. [Content Brief]

[5]. Yang X, et al. Dysfunctional Smad signaling contributes to abnormal smooth muscle cell proliferation in familial pulmonary arterial hypertension. Circ Res. 2005 May 27;96(10):1053-63. [Content Brief]

[6]. Scimeca M, et al. Plaque calcification is driven by different mechanisms of mineralization associated with specific cardiovascular risk factors. Nutr Metab Cardiovasc Dis. 2019 Dec;29(12):1330-1336. [Content Brief]

[7]. David L, et al. Emerging role of bone morphogenetic proteins in angiogenesis. Cytokine Growth Factor Rev. 2009 Jun;20(3):203-12. [Content Brief]

[8]. Dhore CR, et al. Differential expression of bone matrix regulatory proteins in human atherosclerotic plaques. Arterioscler Thromb Vasc Biol. 2001 Dec;21(12):1998-2003. [Content Brief]

[9]. Demer LL, et al. Mechanism of calcification in atherosclerosis. Trends Cardiovasc Med. 1994 Jan-Feb;4(1):45-9. [Content Brief]

[10]. Boström K, et al. Bone morphogenetic protein expression in human atherosclerotic lesions. J Clin Invest. 1993 Apr;91(4):1800-9. [Content Brief]

[11]. Xu RH, et al. BMP4 initiates human embryonic stem cell differentiation to trophoblast. Nat Biotechnol. 2002 Dec;20(12):1261-4. [Content Brief]

[12]. Hatakeyama Y, et al. Distinct functions of BMP4 and GDF5 in the regulation of chondrogenesis. J Cell Biochem. 2004 Apr 15;91(6):1204-17. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to induce alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED50 for this effect is 0.9255 ng/mL, corresponding to a specific activity is 1.08×106 U/mg.

  • 1/16

    BMP-4 Protein, Human purchased from MedChemExpress. Usage Cited in: Elife. 2025 Aug 28:14:RP104774. [Abstract]

    Customer Validation
     Western blot analysis showing the protein levels of pSmad1/5/9, p16, and p21 in response to BMP4 (50 ng/mL, 3 d).

  • 1/16

    BMP-4 Protein, Human purchased from MedChemExpress. Usage Cited in: Elife. 2025 Aug 28:14:RP104774. [Abstract]

    Customer Validation
     Western blot analysis showing the changes in protein levels following BMP4 treatment (50ng/ml, 3 d).

  • 1/16

    BMP-4 Protein, Human purchased from MedChemExpress. Usage Cited in: Elife. 2025 Aug 28:14:RP104774. [Abstract]

    Customer Validation
     Senescence-associated β-galactosidase (SA-β-Gal) staining (left) and corresponding ratio analysis chart (right) following BMP4 (50ng/ml, 3d) treatment.

  • 1/16

    BMP-4 Protein, Human purchased from MedChemExpress. Usage Cited in: Elife. 2025 Aug 28:14:RP104774. [Abstract]

    Customer Validation
     Ki67 immunofluorescence (right) and corresponding ratio analysis chart (left) following BMP4 (50ng/ml, 3d) treatment. Scale bars, 80 μm. Enlarged scale bars, 40 μm.

  • 1/16

    BMP-4 Protein, Human purchased from MedChemExpress. Usage Cited in: Neurosci Bull. 2020 Apr;36(4):372-384. [Abstract]

    Customer Validation
     Intrathecal injection of rhBMP4 (2.5 μL, 1 μg/μL) decreased the percentage of newly-differentiated oligodendrocytes compared with the ESCS group.

  • BMP-4 Protein, Human Product Image
    1/16
  • Experimental Validation Results for BMP-4 Protein, Human
  • Experimental Validation Results for BMP-4 Protein, Human
  • Experimental Validation Results for BMP-4 Protein, Human
  • Experimental Validation Results for BMP-4 Protein, Human
  • Experimental Validation Results for BMP-4 Protein, Human
  • Experimental Validation Results for BMP-4 Protein, Human
  • Experimental Validation Results for BMP-4 Protein, Human
  • BMP-4 Protein, Human Product Image

  • BMP-4 Protein, Human purchased from MedChemExpress. Usage Cited in: Elife. 2025 Aug 28:14:RP104774. [Abstract]

    Western blot analysis showing the protein levels of pSmad1/5/9, p16, and p21 in response to BMP4 (50 ng/mL, 3 d).

  • BMP-4 Protein, Human purchased from MedChemExpress. Usage Cited in: Elife. 2025 Aug 28:14:RP104774. [Abstract]

    Western blot analysis showing the changes in protein levels following BMP4 treatment (50ng/ml, 3 d).

  • BMP-4 Protein, Human purchased from MedChemExpress. Usage Cited in: Elife. 2025 Aug 28:14:RP104774. [Abstract]

    Senescence-associated β-galactosidase (SA-β-Gal) staining (left) and corresponding ratio analysis chart (right) following BMP4 (50ng/ml, 3d) treatment.

  • BMP-4 Protein, Human purchased from MedChemExpress. Usage Cited in: Elife. 2025 Aug 28:14:RP104774. [Abstract]

    Ki67 immunofluorescence (right) and corresponding ratio analysis chart (left) following BMP4 (50ng/ml, 3d) treatment. Scale bars, 80 μm. Enlarged scale bars, 40 μm.

  • BMP-4 Protein, Human purchased from MedChemExpress. Usage Cited in: Neurosci Bull. 2020 Apr;36(4):372-384. [Abstract]

    Intrathecal injection of rhBMP4 (2.5 μL, 1 μg/μL) decreased the percentage of newly-differentiated oligodendrocytes compared with the ESCS group.