BMP-4 Protein, Human
Based on 22 publication(s) in Google Scholar
Bone morphogenetic protein 4 (BMP-4) is a polymorphic ligand protein belonging to the TGF-β family, which is involved in the circulation of the vascular system and can activate receptors on vascular cells. BMP-4 binds to type I receptors (ALK-2/-3/-6) and type II receptors (BMPR2, ACVR2A) to increase plaque formation and promote oxidative stress, endothelial dysfunction, and osteogenic differentiation through its pro-inflammatory and pro-atherogenic effects. BMP-4 Protein, Human has a total length of 116 amino acids (S293-R408), is expressed in E. coli cells with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Bone morphogenetic protein 4 (BMP-4) is a polymorphic ligand protein belonging to the TGF-β family, which is involved in the circulation of the vascular system and can activate receptors on vascular cells[1]. BMP-4 binds to type I receptors (ALK-2/-3/-6) and type II receptors (BMPR2, ACVR2A)[2] to increase plaque formation and promote oxidative stress, endothelial dysfunction, and osteogenic differentiation through its pro-inflammatory and pro-atherogenic effects[3]. BMP-4 Protein, Human has a total length of 116 amino acids (S293-R408), is expressed in E. coli cells with tag free.
Background
Bone Morphogenetic Protein 4 (BMP-4) is a ligand protein with pleiotropic, belongs to TGFβ family. BMP-4 involves in the vasculature circulation and can activate receptors on vascular cells[1].
BMP-4/TGFβ signaling can be terminated by inhibitory SMADs including SMAD6 and SMAD7, which are activated and induced by BMP signaling and switch off BMP signaling via multiple mechanisms[4].
BMP-4 is widely found in different animals, while the sequence in human is highly similar to Rat (96.81%), and mouse (97.54%).
BMP-4 is expressed by endothelial cells (ECs) in response to hypoxia and promotes vascular SMC proliferation. Therefore it inhibits the proliferation of smooth muscle cells (SMCs) isolated from the proximal pulmonary artery while induces proliferation of SMCs isolated from distal pulmonary arteries[5].
BMP-4 appears to be a marker and driver of vascular calcification, particularly in atherosclerosis[6].
BMP-4 induces angiogenesis, endothelial cells (ECs) proliferation, and migration[7].
BMP-4 is differentially expressed in calcified atherosclerotic plaques[8], serves as the linkers between atherosclerotic vascular calcification with mechanisms of normal bone formation[9].
BMP-4 increases plaque formation via their pro-inflammatory and pro-atherogenic effects, promoting oxidative stress, endothelial dysfunction and osteogenic differentiation[3].
In Vitro
BMP-4 (1 ng/mL for 4-5 d; 10 ng/mL for 3-4 d; 100 ng/mL for 2 d) induces a synchronous wave of differentiation occurred, characterized by flattened, enlarged cells with reduced proliferation[10].
BMP-4 (100 ng/mL; 7 d) initiates human embryonic stem cell differentiation to trophoblast[10].
BMP4 (10 or 100 ng/mL; 24 h) significantly increases the number of mesenchymal condensations by approximately 50%[11].
Verified Bioactivity
Measured by its ability to induce alkaline phosphatase production by ATDC5 mouse chondrogenic cells.The ED50 for this effect is < 60 ng/mL.
Publications (22)
-
Journal Impact Factor
-
Most Recent
-
Cell Stem Cell
Mouse totipotent blastomere-like cells model embryogenesis from zygotic genome activation to post implantation. [Abstract]2025 Mar 6;32(3):391-408.e11. PMID: 39826539 -
MedComm (2020)
Gene Therapy Targeting Pkp2 Deficiency Attenuates Cardiac Fibrosis: Insights From Single-Cell Transcriptomics in Pkp2-Knockout Rats. [Abstract]2025 Sep 18;6(10):e70392. PMID: 40979216 -
Adv Sci (Weinh)
2025 Feb;12(6):e2408852. PMID: 39630006 -
Sci Adv
GPAM mediates mitochondrial dysfunction and the progression of alcoholic liver disease through lipid remodeling. [Abstract]2026 Jun 26;12(26):eaef1896. PMID: 42341117 -
Sci Adv
Generation of vascularized retinal organoids containing microglia based on a PDMS microwell platform. [Abstract]2025 Oct 10;11(41):eady6410. PMID: 41071880 -
-
Cell Rep
2022 Dec 27;41(13):111891. PMID: 36577384 -
Neurosci Bull
Epidural Spinal Cord Stimulation Promotes Motor Functional Recovery by Enhancing Oligodendrocyte Survival and Differentiation and by Protecting Myelin after Spinal Cord Injury in Rats. [Abstract]2020 Apr;36(4):372-384. PMID: 31732865
BMP-4 Protein, Human purchased from MedChemExpress. Usage Cited in: Neurosci Bull. 2020 Apr;36(4):372-384. [Abstract]
Intrathecal injection of rhBMP4 (2.5 μL, 1 μg/μL) decreased the percentage of newly-differentiated oligodendrocytes compared with the ESCS group.
-
Eur J Pharmacol
Therapeutic inhibition of PHF21B attenuates pathological cardiac hypertrophy by inhibiting the BMP4/GSK3β/β-catenin axis. [Abstract]2025 Mar 15:991:177346. PMID: 39900327 -
Toxicol Sci
2023 Feb 17;191(2):201-211. PMID: 36453845 -
Oncol Rep
POSTN+ fibroblast‑secreted small extracellular vesicles drive macrophage M2 polarization through BMP4/BMPR2/Smad signaling. [Abstract]2026 Apr;55(4):62. PMID: 41645751 -
J Dermatol Sci
A novel ZIC1-BMP4 axis identified in photoaged dermal fibroblasts regulates melanogenesis. [Abstract]2026 Mar 10:S0923-1811(26)00052-6. PMID: 41864822 -
Theriogenology
Expression and regulation of Noggin4 gene in chicken ovarian follicles and its role in the proliferation and differentiation of granulosa cells. [Abstract]2023 Dec:212:83-90. PMID: 37717518 -
-
-
-
Elife
Enalapril mitigates senescence and aging-related phenotypes in human cells and mice via pSmad1/5/9-driven antioxidative genes. [Abstract]2025 Aug 28:14:RP104774. PMID: 40874922
BMP-4 Protein, Human purchased from MedChemExpress. Usage Cited in: Elife. 2025 Aug 28:14:RP104774. [Abstract]
Western blot analysis showing the protein levels of pSmad1/5/9, p16, and p21 in response to BMP4 (50 ng/mL, 3 d).
BMP-4 Protein, Human purchased from MedChemExpress. Usage Cited in: Elife. 2025 Aug 28:14:RP104774. [Abstract]
Western blot analysis showing the changes in protein levels following BMP4 treatment (50ng/ml, 3 d).
BMP-4 Protein, Human purchased from MedChemExpress. Usage Cited in: Elife. 2025 Aug 28:14:RP104774. [Abstract]
Senescence-associated β-galactosidase (SA-β-Gal) staining (left) and corresponding ratio analysis chart (right) following BMP4 (50ng/ml, 3d) treatment.
BMP-4 Protein, Human purchased from MedChemExpress. Usage Cited in: Elife. 2025 Aug 28:14:RP104774. [Abstract]
Ki67 immunofluorescence (right) and corresponding ratio analysis chart (left) following BMP4 (50ng/ml, 3d) treatment. Scale bars, 80 μm. Enlarged scale bars, 40 μm.
-
bioRxiv
2025 Jun 19:2025.06.15.659815. PMID: 40667248 -
-
-
Heliyon
2023 Feb 18;9(3):e13824. PMID: 36895361 -
Oxid Med Cell Longev
The Attenuating Effect of the Intraovarian Bone Morphogenetic Protein 4 on Age-Related Endoplasmic Reticulum Stress in Chicken Follicular Cells. [Abstract]2020 Jun 8:2020:4175613. PMID: 32587659
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P12644 (S293-R408)
-
Molecular Construction
-
N-term
-
BMP-4 (S293-R408)
Accession # P12644 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
BMP4; MCOPS6; Prev. BMP2B; OFC11; Bone Morphogenetic Protein 2B; BMP-4; Bone Morphogenetic Protein 4 Preproprotein; ZYME; Alternative Protein BMP4; DVR4; BMP2B1; Bone Morphogenetic Protein 4; BMP-2B
-
AA Sequence
SPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
-
Predicted Molecular Mass
13.1 kDa
-
Molecular Weight
Approximately 13 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of 50 mM Na2CO3, 5 mM DTT, pH 11.0.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 200 mM NaCL, 500 mM arginine, pH 8.0.
3.Lyophilized from a 0.22 μm filtered solution of 0.1% TFA, 30% Acetonitrile, pH 2.5.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (265 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Yang P, et al. The role of bone morphogenetic protein signaling in vascular calcification. Bone. 2020 Dec;141:115542. [Content Brief]
[2]. Gieseler GM, et al. Solubilization and renaturation of biologically active human bone morphogenetic protein-4 from inclusion bodies. Biotechnol Rep (Amst). 2018 Apr 4;18:e00249. [Content Brief]
[3]. Miyazawa K, et al. Regulation of TGF-β Family Signaling by Inhibitory Smads. Cold Spring Harb Perspect Biol. 2017 Mar 1;9(3):a022095. [Content Brief]
[4]. Herrera B, et al. A rapid and sensitive bioassay for the simultaneous measurement of multiple bone morphogenetic proteins. Identification and quantification of BMP4, BMP6 and BMP9 in bovine and human serum. BMC Cell Biol. 2009 Mar 19;10:20. [Content Brief]
[5]. Yang X, et al. Dysfunctional Smad signaling contributes to abnormal smooth muscle cell proliferation in familial pulmonary arterial hypertension. Circ Res. 2005 May 27;96(10):1053-63. [Content Brief]
[6]. Scimeca M, et al. Plaque calcification is driven by different mechanisms of mineralization associated with specific cardiovascular risk factors. Nutr Metab Cardiovasc Dis. 2019 Dec;29(12):1330-1336. [Content Brief]
[7]. David L, et al. Emerging role of bone morphogenetic proteins in angiogenesis. Cytokine Growth Factor Rev. 2009 Jun;20(3):203-12. [Content Brief]
[8]. Dhore CR, et al. Differential expression of bone matrix regulatory proteins in human atherosclerotic plaques. Arterioscler Thromb Vasc Biol. 2001 Dec;21(12):1998-2003. [Content Brief]
[9]. Demer LL, et al. Mechanism of calcification in atherosclerosis. Trends Cardiovasc Med. 1994 Jan-Feb;4(1):45-9. [Content Brief]
[10]. Boström K, et al. Bone morphogenetic protein expression in human atherosclerotic lesions. J Clin Invest. 1993 Apr;91(4):1800-9. [Content Brief]
[11]. Xu RH, et al. BMP4 initiates human embryonic stem cell differentiation to trophoblast. Nat Biotechnol. 2002 Dec;20(12):1261-4. [Content Brief]
[12]. Hatakeyama Y, et al. Distinct functions of BMP4 and GDF5 in the regulation of chondrogenesis. J Cell Biochem. 2004 Apr 15;91(6):1204-17. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)