1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. VEGFs & VEGFRs
  4. VEGFs
  5. VEGF164 Protein, Mouse (186a.a, P.pastoris)

VEGF164 Protein, Mouse (186a.a, P.pastoris)

Cat. No.: HY-P7421
Handling Instructions

VEGF164 Protein, Mouse (186a.a, P.pastoris), a VEGF isoform splice variant, is more potent at inducing endothelial ICAM-1 expression by VEGFR-2, leukocyte migration by VEGFR-1, and inflammation and angiogenesis in the adult cornea.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $190 In-stock
Estimated Time of Arrival: December 31
50 μg $490 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

VEGF164 Protein, Mouse (186a.a, P.pastoris) Featured Recommendations:

Top Publications Citing Use of Products

VEGF164 Protein, Mouse (186a.a, P.pastoris) Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Mouse

Source

P. pastoris

Tag

Tag Free

Accession

Q00731 (T29-R214)

Gene ID

22339

Synonyms
rMuVEGF164; VEGF-A; VPF
AA Sequence

MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Molecular Weight

Approximately 39 kDa

Biological Activity
The ED50 is <6 ng/mL as measured by HUVEC cells, corresponding to a specific activity of >1.7 × 105 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 25 mM HEPES and 150 mM NaCl, pH 7.0.

Endotoxin Level

<1.0 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

VEGF164 (165) is a proinflammatory isoform. VEGF164 was found to be significantly more potent at inducing inflammation. In vivo blockade of VEGF receptor (VEGFR)-1 significantly suppressed VEGF164-induced corneal inflammation. In vitro, VEGF164 more potently stimulated intracellular adhesion molecule (ICAM)-1 expression on endothelial cells, an effect that was mediated by VEGFR2. VEGF164 was also more potent at inducing the chemotaxis of monocytes, an effect that was mediated by VEGFR1. In an immortalized human leukocyte cell line, VEGF164 was found to induce tyrosine phosphorylation of VEGFR1 more efficiently[1]. VEGF164 is an important isoform in the pathogenesis of early diabetic retinopathy[2].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
VEGF164 Protein, Mouse (186a.a, P.pastoris)
Cat. No.:
HY-P7421
Quantity:
MCE Japan Authorized Agent: