VEGF164 Protein, Mouse (186a.a, P.pastoris)

VEGF164 Protein, Mouse (186a.a, P.pastoris), a VEGF isoform splice variant, is more potent at inducing endothelial ICAM-1 expression by VEGFR-2, leukocyte migration by VEGFR-1, and inflammation and angiogenesis in the adult cornea.

VEGF164 was found to be significantly more potent at inducing inflammation. In vivo blockade of VEGF receptor (VEGFR)-1 significantly suppressed VEGF164-induced corneal inflammation. In vitro, VEGF164 more potently stimulated intracellular adhesion molecule (ICAM)-1 expression on endothelial cells, an effect that was mediated by VEGFR2. VEGF164 was also more potent at inducing the chemotaxis of monocytes, an effect that was mediated by VEGFR1. In an immortalized human leukocyte cell line, VEGF164 was found to induce tyrosine phosphorylation of VEGFR1 more efficiently^[1]. VEGF164 is an important isoform in the pathogenesis of early diabetic retinopathy^[2].

The ED₅₀ is <6 ng/mL as measured by HUVEC cells, corresponding to a specific activity of >1.7 × 10⁵ units/mg.

Mouse

P. pastoris

Tag Free

Q00731-2 (A27-R190)

22339  [NCBI]

MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Approximately 39 kDa (Disulfide-linked homodimer)

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against 25 mM HEPES and 150 mM NaCl, pH 7.0.

<1.0 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Usui T, et al. VEGF164(165) as the pathological isoform: differential leukocyte and endothelial responses through VEGFR1 and VEGFR2. Invest Ophthalmol Vis Sci. 2004 Feb;45(2):368-74.  [Content Brief]

  [2]. Ishida S,et al. VEGF164 is proinflammatory in the diabetic retina. Invest Ophthalmol Vis Sci. 2003 May;44(5):2155-62.  [Content Brief]