XG/Xg blood group Protein, Human (HEK293, His)

XG/Xg blood group Protein is a type I transmembrane glycoprotein belonging to the CD99 family. It is a erythrocyte membrane protein that is used as the basis of the Xg blood group system. XG/Xg blood group Protein, Human (HEK293, His) is the recombinant human-derived XG/Xg blood group protein, expressed by HEK293 , with C-His labeled tag.

XG/Xg blood group Protein is a type I transmembrane glycoprotein belonging to the CD99 family. It is a erythrocyte membrane protein that is used as the basis of the Xg blood group system^[1].

Human

HEK293

C-His

P55808-2 (Q22-K143)

7499  [NCBI]

Partial

QRDFDLADALDDPEPTKKPNSDIYPKPKPPYYPQPENPDSGGNIYPRPKPRPQPQPGNSGNSGGSYFNDVDRDDGRYPPRPRPRPPAGGGGGGYSSYGNSDNTHGGDHHSTYGNPEGNMVAK

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.