1. Recombinant Proteins
  2. Others
  3. ZNRF3 Protein, Human (HEK293, His)

ZNRF3, as an E3 ubiquitin protein ligase, plays a crucial role as a negative regulator in the Wnt signaling pathway. It does this by mediating the ubiquitination and subsequent degradation of components within the Wnt receptor complex, namely Frizzled and LRP6. ZNRF3 Protein, Human (HEK293, His) is the recombinant human-derived ZNRF3 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ZNRF3, as an E3 ubiquitin protein ligase, plays a crucial role as a negative regulator in the Wnt signaling pathway. It does this by mediating the ubiquitination and subsequent degradation of components within the Wnt receptor complex, namely Frizzled and LRP6. ZNRF3 Protein, Human (HEK293, His) is the recombinant human-derived ZNRF3 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

ZNRF3 is an E3 ubiquitin-protein ligase that functions as a crucial negative regulator of the Wnt signaling pathway. By mediating the ubiquitination and subsequent degradation of key components in the Wnt receptor complex, including Frizzled and LRP6, ZNRF3 plays a pivotal role in modulating both canonical and non-canonical Wnt signaling pathways. Particularly, in the intestinal stem cell zone, ZNRF3 acts as a tumor suppressor by inhibiting Wnt signaling, thereby restricting the size of the intestinal stem cell zone. This regulatory function underscores its significance in controlling cellular processes. In conjunction with RSPO2 and RNF43, ZNRF3 constitutes a master switch governing limb specification, highlighting its broader involvement in developmental pathways.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized ZNRF3 Protein, Human (HEK293, His) at 5 μg/mL can bind Human RSPO2, the ED50 is ≤10 ng/mL.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q9ULT6-1 (K56-M219)

Gene ID
Molecular Construction
N-term
ZNRF3 (K56-M219)
Accession # Q9ULT6-1
6*His
C-term
Protein Length

Extracellular Domain

Synonyms
ZNRF3; Zinc; RING finger protein 3; RING-type E3 ubiquitin transferase ZNRF3; RING finger protein 203; KIAA1133; RNF203
AA Sequence

KETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGATLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHRPPRQPTEYFDM

Molecular Weight

Approximately 21 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized a 0.22 μm filtered solution of PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ZNRF3 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ZNRF3 Protein, Human (HEK293, His)
Cat. No.:
HY-P78750
Quantity:
MCE Japan Authorized Agent: