Copy Link Print Information

ZNRF3 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

ZNRF3, as an E3 ubiquitin protein ligase, plays a crucial role as a negative regulator in the Wnt signaling pathway. It does this by mediating the ubiquitination and subsequent degradation of components within the Wnt receptor complex, namely Frizzled and LRP6. ZNRF3 Protein, Human (HEK293, His) is the recombinant human-derived ZNRF3 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • ZNRF3 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

ZNRF3, as an E3 ubiquitin protein ligase, plays a crucial role as a negative regulator in the Wnt signaling pathway. It does this by mediating the ubiquitination and subsequent degradation of components within the Wnt receptor complex, namely Frizzled and LRP6. ZNRF3 Protein, Human (HEK293, His) is the recombinant human-derived ZNRF3 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

ZNRF3 is an E3 ubiquitin-protein ligase that functions as a crucial negative regulator of the Wnt signaling pathway. By mediating the ubiquitination and subsequent degradation of key components in the Wnt receptor complex, including Frizzled and LRP6, ZNRF3 plays a pivotal role in modulating both canonical and non-canonical Wnt signaling pathways. Particularly, in the intestinal stem cell zone, ZNRF3 acts as a tumor suppressor by inhibiting Wnt signaling, thereby restricting the size of the intestinal stem cell zone. This regulatory function underscores its significance in controlling cellular processes. In conjunction with RSPO2 and RNF43, ZNRF3 constitutes a master switch governing limb specification, highlighting its broader involvement in developmental pathways.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized ZNRF3 Protein, Human (HEK293, His) at 5 μg/mL can bind Human RSPO2, the ED50 is ≤10 ng/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    Q9ULT6-1 (K56-M219)

  • Gene ID
    84133  [NCBI]
  • Molecular Construction
    • N-term
    • ZNRF3 (K56-M219)
      Accession # Q9ULT6-1
    • 6*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    ZNRF3; Zinc/RING Finger Protein 3; Zinc And Ring Finger 3; RING Finger Protein 203; RNF203; FLJ22057; BK747E2.3; Novel C3HC4 Type Zinc Finger (Ring Finger); KIAA1133; ZNRF3 Protein; RING-Type E3 Ubiquitin Transferase ZNRF3; CTA-292E10.6; E3 Ubiquitin-Prot

  • AA Sequence

    KETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGATLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHRPPRQPTEYFDM

  • Predicted Molecular Mass

    20.4 kDa

  • Molecular Weight

    Approximately 22-25 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • ZNRF3 Protein, Human (HEK293, His) Product Image
    1/16
  • ZNRF3 Protein, Human (HEK293, His) Product Image