VIP(Guinea pig) TFA  (Synonyms: Vasoactive Intestinal Peptide, guinea pig TFA)

VIP Guinea pig TFA (Vasoactive intestinal peptide), a trophic and mitogenic factor, stimulates growth in whole cultured embryos. VIP Guinea pig functions as a simple gastrointestinal hormone and suggest a possible neurotransmitter function^[1][2].

Vasoactive intestinal peptide (10(-7)M) shortened S phase and G1 phase of neuroepithelial cells by 50% (4.8-2.4 h) and 58% (1.9-0.8 h), respectively, compared with controls^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

3458.88

C₁₄₇H₂₃₉N₄₃O₄₂S₂.C₂HF₃O₂

His-Ser-Asp-Ala-Leu-Phe-Thr-Asp-Thr-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Met-Lys-Lys-Tyr-Leu-Asn-Ser-Val-Leu-Asn-NH2

HSDALFTDTYTRLRKQMAMKKYLNSVLN-NH2

Room temperature in continental US; may vary elsewhere.

Please store the product under the recommended conditions in the Certificate of Analysis.

• [1]. P Gressens, et al. Vasoactive intestinal peptide shortens both G1 and S phases of neural cell cycle in whole postimplantation cultured mouse embryos. Eur J Neurosci. 1998 May;10(5):1734-42.  [Content Brief]

  [2]. M G Bryant, et al. Possible dual role for vasoactive intestinal peptide as gastrointestinal hormone and neurotransmitter substance. Lancet. 1976 May 8;1(7967):991-3.  [Content Brief]