1. Others
  2. Others

Adrenocorticotropic Hormone (ACTH) (1-39), rat TFA (Synonyms: ACTH (1-39) (mouse, rat) (TFA))

Cat. No.: HY-P1477A
Handling Instructions

Adrenocorticotropic Hormone (ACTH) (1-39), rat (TFA) is a potent melanocortin 2 (MC2) receptor agonist.

For research use only. We do not sell to patients.

Adrenocorticotropic Hormone (ACTH) (1-39), rat TFA Chemical Structure

Adrenocorticotropic Hormone (ACTH) (1-39), rat TFA Chemical Structure

Size Price Stock Quantity
10 mM * 1 mL in DMSO USD 9918 In-stock
Estimated Time of Arrival: December 31
500 μg USD 150 In-stock
Estimated Time of Arrival: December 31
1 mg USD 240 In-stock
Estimated Time of Arrival: December 31
5 mg USD 960 In-stock
Estimated Time of Arrival: December 31
10 mg   Get quote  
50 mg   Get quote  

* Please select Quantity before adding items.

Other Forms of Adrenocorticotropic Hormone (ACTH) (1-39), rat TFA:

  • Biological Activity

  • Technical Information

  • Purity & Documentation

Description

Adrenocorticotropic Hormone (ACTH) (1-39), rat (TFA) is a potent melanocortin 2 (MC2) receptor agonist.

Solvent & Solubility
In Vitro: 

10 mM in DMSO

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2129 mL 1.0647 mL 2.1294 mL
5 mM 0.0426 mL 0.2129 mL 0.4259 mL
10 mM 0.0213 mL 0.1065 mL 0.2129 mL
*Please refer to the solubility information to select the appropriate solvent.
Molecular Weight

4696.18

Formula

C₂₁₂H₃₁₆F₃N₅₇O₅₉S

SMILES

FC(C(O)=O)(F)F.[SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF]

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Shipping

Room temperature in continental US; may vary elsewhere

  • 陆丹丹要求上线20181114; Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Val-Ala-Glu-Asn-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Adrenocorticotropic Hormone (ACTH) (1-39), rat TFA
Cat. No.:
HY-P1477A
Quantity:

Adrenocorticotropic Hormone (ACTH) (1-39), rat TFA

Cat. No.: HY-P1477A