Adrenomedullin (1-50), rat
Based on 1 Customer Validation
Adrenomedullin (1-50), rat is a 50 amino acid peptide, which induces a selective arterial vasodilation via activation of CGRP1 receptor.
For research use only. We do not sell to patients.
- Purity : 99.56%
- CAS No.: 161383-47-7
- Formula: C242H381N77O75S5
- Molecular Weight:5729.50
-
Storage:
Sealed storage, away from moisture and light, under nitrogen.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
Biological Activity
Description
IC50 & Target
CGRP1 receptor[1]
In Vitro
Adrenomedullin (1-50), rat is a 50 amino acid peptide, which induces a selective arterial vasodilation via activation of CGRP1 receptor[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
In Vivo
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
CAS No. 161383-47-7
-
Appearance Solid
-
Molecular Weight 5729.50
-
Formula C242H381N77O75S5
-
Color White to off-white
-
Synonyms
Adrenomedullin (rat)
-
Sequence
Tyr-Arg-Gln-Ser-Met-Asn-Gln-Gly-Ser-Arg-Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (Disulfide bridge: Cys14-Cys19)
-
Sequence Shortening
YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 (Disulfide bridge: Cys14-Cys19)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture and light, under nitrogen
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)
Solvent & Solubility
In Vitro:
DMSO : 50 mg/mL (8.73 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Protocol
Animal Administration[1]
Rats[1]
Male albino Wistar rats (250-350 g) are used in the assay. Following an equilibration period of 45 min, the vasoactive effect of Adrenomedullin (1-50), rat, rADM (11-50), acetylcholine (ACh), and bradykinin (BK) is evaluated. The perfusion pressure on both sides of the mesenteric circulation is increased by infusing either a sympathomimetic, methoxamine (100 μM), on the arterial side or a thromboxomimetic, U46619 (0.5 μM), on the venous side. When a plateau is reached, the agents (Adrenomedullin (1-50), rat, etc.) are administered by bolus injections (1 to 45 μL). Vasodilator responses are expressed as percent reduction of induced tone on both sides of the mesenteric vasculature. In some experiments, the effects of the CGRP1 receptor antagonist hCGRP8-37 and of the nitric oxide synthase inhibitor L-NAME are evaluated. They are infused 15 and 30 min, respectively, before the administration of the agonists[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Purity & Documentation
-
Data Sheet (272 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
References
[1]. Berthiaume N, et al. Rat adrenomedullin induces a selective arterial vasodilation via CGRP1 receptors in the double-perfused mesenteric bed of the rat. Can J Physiol Pharmacol. 1995 Jul;73(7):1080-3. [Content Brief]
[2]. Qi JG, et al. Effect of adrenomedullin 1-50 on chronic hypoxic pulmonary hypertension in rats. Beijing Da Xue Xue Bao Yi Xue Ban. 2006 Apr 18;38(2):151-4. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| DMSO | 1 mM | 0.1745 mL | 0.8727 mL | 1.7454 mL | 4.3634 mL |
| 5 mM | 0.0349 mL | 0.1745 mL | 0.3491 mL | 0.8727 mL |