1. GPCR/G Protein
    Neuronal Signaling
  2. CGRP Receptor

Adrenomedullin (1-50), rat 

Cat. No.: HY-P1534
Handling Instructions

Adrenomedullin (1-50), rat is a 50 amino acid peptide, which induces a selective arterial vasodilation via activation of CGRP1 receptor. Sequence: Tyr-Arg-Gln-Ser-Met-Asn-Gln-Gly-Ser-Arg-Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (Disulfide bridge: Cys14-Cys19);YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 (Disulfide bridge: Cys14-Cys19).

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Adrenomedullin (1-50), rat Chemical Structure

Adrenomedullin (1-50), rat Chemical Structure

Size Price Stock
500 μg USD 250 Get quote
1 mg USD 350 Get quote
5 mg USD 1200 Get quote

* Please select Quantity before adding items.

Customer Review

  • Biological Activity

  • Protocol

  • Technical Information

  • Purity & Documentation

  • References


Adrenomedullin (1-50), rat is a 50 amino acid peptide, which induces a selective arterial vasodilation via activation of CGRP1 receptor. Sequence: Tyr-Arg-Gln-Ser-Met-Asn-Gln-Gly-Ser-Arg-Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 (Disulfide bridge: Cys14-Cys19);YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 (Disulfide bridge: Cys14-Cys19).

IC50 & Target

CGRP1 receptor[1]

In Vitro

Adrenomedullin (1-50), rat is a 50 amino acid peptide, which induces a selective arterial vasodilation via activation of CGRP1 receptor[1].

In Vivo

Adrenomedullin (1-50), rat causes a dose-dependent and endothelium-independent vasodilation on the arterial mesenteric vasculature, and this effect is inhibited by CGRP1 receptor antagonist. Adrenomedullin (1-50), rat activates CGRP1 receptor in the double-perfused mesenteric bed of the rat[1]. Adrenomedullin (1-50) ameliorates pulmonary vascular structural remodeling of hypoxic rats with incresed plasma NO and H(2)S concentrations. Adrenomedullin (1-50) also regulates the development of hypoxic pulmonary hypertension and hypoxic pulmonary vascular structural remodeling, through promoting NO and H(2)S production in hypoxic rats[2].

Solvent & Solubility
In Vitro: 

10 mM in H2O

Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.1745 mL 0.8727 mL 1.7454 mL
5 mM 0.0349 mL 0.1745 mL 0.3491 mL
10 mM 0.0175 mL 0.0873 mL 0.1745 mL
*Please refer to the solubility information to select the appropriate solvent.
Animal Administration

Male albino Wistar rats (250-350 g) are used in the assay. Following an equilibration period of 45 min, the vasoactive effect of Adrenomedullin (1-50), rat, rADM (11-50), acetylcholine (ACh), and bradykinin (BK) is evaluated. The perfusion pressure on both sides of the mesenteric circulation is increased by infusing either a sympathomimetic, methoxamine (100 μM), on the arterial side or a thromboxomimetic, U46619 (0.5 μM), on the venous side. When a plateau is reached, the agents (Adrenomedullin (1-50), rat, etc.) are administered by bolus injections (1 to 45 μL). Vasodilator responses are expressed as percent reduction of induced tone on both sides of the mesenteric vasculature. In some experiments, the effects of the CGRP1 receptor antagonist hCGRP8-37 and of the nitric oxide synthase inhibitor L-NAME are evaluated. They are infused 15 and 30 min, respectively, before the administration of the agonists[1].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight





Please store the product under the recommended conditions in the Certificate of Analysis.


Room temperature in continental US; may vary elsewhere

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Inquiry Online

Your information is safe with us. * Required Fields.

Product name



Applicant name *


Email address *

Phone number *


Organization name *

Country or Region *


Requested quantity *


Bulk Inquiry

Inquiry Information

Product Name:
Adrenomedullin (1-50), rat
Cat. No.:

Adrenomedullin (1-50), rat

Cat. No.: HY-P1534