1. GPCR/G Protein
  2. Glucagon Receptor


Cat. No.: HY-P1229 Purity: 98.01%
Data Sheet SDS Handling Instructions

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

For research use only. We do not sell to patients.


Size Price Stock Quantity
10 mM * 1 mL in DMSO USD 7310 In-stock
1 mg USD 336 In-stock
5 mg USD 1176 In-stock
10 mg USD 1800 In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

  • Biological Activity

  • Protocol

  • Technical Information

  • Purity & Documentation

  • References


FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

In Vitro

Exendin-4 is a pure GLP-1 receptor agonist. Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists. Their medical use, for example in the treatment of disorders of the metabolic syndrome, including diabetes and obesity, as well as for reduction of excess food intake. These dual GLP-1/glucagon receptor agonists show reduced activity on the GIP receptor to reduce the risk of hypoglycemia[1].

Preparing Stock Solutions
Concentration Volume Mass 1 mg 5 mg 10 mg
1 mM 0.2708 mL 1.3542 mL 2.7084 mL
5 mM 0.0542 mL 0.2708 mL 0.5417 mL
10 mM 0.0271 mL 0.1354 mL 0.2708 mL
Please refer to the solubility information to select the appropriate solvent.
Molecular Weight


Protect from light
Powder -80°C 2 years
  -20°C 1 year
In solvent -80°C 6 months
  -20°C 1 month

Room temperature in continental US; may vary elsewhere

Solvent & Solubility


* "<1 mg/mL" means slightly soluble or insoluble. "≥" means soluble, but saturation unknown.

Inquiry Online

Your information is safe with us. * Required Fields.

Product name



Applicant name *


Email address *

Phone number *


Organization name *

Country *


Requested quantity *


Bulk Inquiry

Inquiry Information

Product Name:
Cat. No.: