1. GPCR/G Protein
  2. Glucagon Receptor

GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS 

Cat. No.: HY-P1231 Purity: 99.03%
Handling Instructions

GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative. Sequence: Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS Chemical Structure

GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS Chemical Structure

Size Price Stock Quantity
1 mg USD 336 In-stock
Stock in the United States
Estimated Time of Arrival: December 31
5 mg USD 1176 In-stock
Stock in the United States
Estimated Time of Arrival: December 31
10 mg USD 1800 In-stock
Stock in the United States
Estimated Time of Arrival: December 31
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

  • Biological Activity

  • Technical Information

  • Purity & Documentation

  • References

Description

GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative. Sequence: Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser.

In Vitro

Exendin-4 is a pure GLP-1 receptor agonist. Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists. Their medical use, for example in the treatment of disorders of the metabolic syndrome, including diabetes and obesity, as well as for reduction of excess food intake. These dual GLP-1/glucagon receptor agonists show reduced activity on the GIP receptor to reduce the risk of hypoglycemia[1].

Solvent & Solubility
In Vitro: 

10 mM in DMSO

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2597 mL 1.2986 mL 2.5972 mL
5 mM 0.0519 mL 0.2597 mL 0.5194 mL
10 mM 0.0260 mL 0.1299 mL 0.2597 mL
*Please refer to the solubility information to select the appropriate solvent.
References
Molecular Weight

3850.31

Storage
Protect from light
Powder -80°C 2 years
  -20°C 1 year
In solvent -80°C 6 months
  -20°C 1 month
Shipping

Room temperature in continental US; may vary elsewhere

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Cat. No.:
HY-P1231
Quantity:

GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Cat. No.: HY-P1231