1. Peptides
  2. VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS 

Cat. No.: HY-P1225 Purity: 99.45%
Handling Instructions

VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is the first N-terminal 1-28 residues of Exendin-4 peptide.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS Chemical Structure

VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS Chemical Structure

Size Price Stock Quantity
1 mg USD 336 In-stock
Estimated Time of Arrival: December 31
5 mg USD 1176 In-stock
Estimated Time of Arrival: December 31
10 mg USD 1800 In-stock
Estimated Time of Arrival: December 31
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

Customer Review

Based on 1 publication(s) in Google Scholar

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Information

  • Purity & Documentation

  • References

Description

VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is the first N-terminal 1-28 residues of Exendin-4 peptide.

In Vitro

Exendin-4 is a pure GLP-1 receptor agonist. Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists. Their medical use, for example in the treatment of disorders of the metabolic syndrome, including diabetes and obesity, as well as for reduction of excess food intake. These dual GLP-1/glucagon receptor agonists show reduced activity on the GIP receptor to reduce the risk of hypoglycemia[1].

Storage
Protect from light
Powder -80°C 2 years
  -20°C 1 year
In solvent -80°C 6 months
  -20°C 1 month
Solvent & Solubility
In Vitro: 

H2O

Peptide Solubility and Storage Guidelines:

1.  Calculate the length of the peptide.

2.  Calculate the overall charge of the entire peptide according to the following table:

  Contents Assign value
Acidic amino acid Asp (D), Glu (E), and the C-terminal -COOH. -1
Basic amino acid Arg (R), Lys (K), His (H), and the N-terminal -NH2 +1
Neutral amino acid Gly (G), Ala (A), Leu (L), Ile (I), Val (V), Cys (C), Met (M), Thr (T), Ser (S), Phe (F), Tyr (Y), Trp (W), Pro (P), Asn (N), Gln (Q) 0

3.  Recommended solution:

Overall charge of peptide Details
Negative (<0) 1.  Try to dissolve the peptide in water first.
2.  If water fails, add NH4OH (<50 μL).
3.  If the peptide still does not dissolve, add DMSO (50-100 μL) to solubilize the peptide.
Positive (>0) 1.  Try to dissolve the peptide in water first.
2.  If water fails, try dissolving the peptide in a 10%-30% acetic acid solution.
3.  If the peptide still does not dissolve, try dissolving the peptide in a small amount of DMSO.
Zero (=0) 1.  Try to dissolve the peptide in organic solvent (acetonitrile, methanol, etc.) first.
2.  For very hydrophobic peptides, try dissolving the peptide in a small amount of DMSO, and then dilute the solution with water to the desired concentration.
References
Molecular Weight

3241.70

Sequence

Val-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser

Sequence Shortening

VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Shipping

Room temperature in continental US; may vary elsewhere

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Cat. No.:
HY-P1225
Quantity:

VSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

Cat. No.: HY-P1225