β-Endorphin, human

Name: β-Endorphin, human
Brand: MedChemExpress
SKU: HY-P1502
Rating: 4.5 (1 reviews)

Cat. No.: HY-P1502 Purity: 97.04%: FAQs
Data Sheet SDS COA Handling Instructions

Molarity Calculator

β-Endorphin, human, a prominent endogenous peptide, existing in the hypophysis cerebri and hypothalamus, is an agonist of opioid receptor, with preferred affinity for μ-opioid receptor and δ-opioid receptor; β-Endorphin, human exhibits antinociception activity.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

β-Endorphin, human Chemical Structure

CAS No. : 61214-51-5

Size	Price	Stock	Quantity
1 mg	USD 140	In-stock	Estimated Time of Arrival: December 31
5 mg	USD 420	In-stock	Estimated Time of Arrival: December 31
10 mg	USD 670	In-stock	Estimated Time of Arrival: December 31
25 mg	USD 1340	In-stock	Estimated Time of Arrival: December 31
50 mg		Get quote
100 mg		Get quote

or Bulk Inquiry

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of β-Endorphin, human:

Biocytin-β-endorphin, human Get quote

1 Publications Citing Use of MCE β-Endorphin, human

•Nat Commun. 2023 Sep 12;14(1):5601. [Abstract]

Featured Recommendations

•Related Screening Libraries:

•Related Small Molecules:

•Related Proteins:

Biological Activity
Purity & Documentation
References
Customer Review

Description

IC₅₀ & Target

δ Opioid Receptor/DOR

In Vitro

β-Endorphin, human is an agonist of opioid receptor, with preferred affinity for μ-opioid receptor and δ-opioid receptor. β-Endorphin exhibits anti-nociception activity by stimulating ε-opioid receptor, rather than μ-, δ-, and κ-opioid receptor^[1]. β-Endorphin has anti-nociception activity. Firstly, β-Endorphin combines together with the opioid receptors in hyperalgesia. Further, β-Endorphin suppresses the release of substance P at the level of spinal cord and blocks the conduction of pain on the primary sensory neurons. Moreover, β-Endorphin activates the endogenous analgesia system located in the CNS. In addition, β-Endorphin inhibits the conduction of pain and agitation of nociceptors to exert an analgesic effect^[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

3464.98

Formula

C₁₅₈H₂₅₁N₃₉O₄₆S

CAS No.

61214-51-5

Appearance

Solid

Color

White to off-white

Sequence

Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu

Sequence Shortening

YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder	-80°C	2 years
	-20°C	1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility

In Vitro:

DMSO : 100 mg/mL (28.86 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

H₂O : ≥ 50 mg/mL (14.43 mM)

*"≥" means soluble, but saturation unknown.

Preparing
Stock Solutions

Concentration Solvent Mass	1 mg	5 mg	10 mg

1 mM	0.2886 mL	1.4430 mL	2.8860 mL
5 mM	0.0577 mL	0.2886 mL	0.5772 mL
10 mM	0.0289 mL	0.1443 mL	0.2886 mL

View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

Molarity Calculator
Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

In Vivo Dissolution Calculator

Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.

Calculation results:

Working solution concentration: mg/mL

This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.

The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).

Purity & Documentation

Purity: 97.04%

Select Batch:

Data Sheet (272 KB) SDS (252 KB)

COA (241 KB) RP-HPLC (205 KB) MS (69 KB)

Handling Instructions (2659 KB)

References

[1]. Narita M, et al. Evidence for the existence of the beta-endorphin-sensitive "epsilon-opioid receptor" in the brain: the mechanisms of epsilon-mediated antinociception. Jpn J Pharmacol. 1998 Mar;76(3):233-53. [Content Brief]

[2]. Luan YH, et al. Action of β-endorphin and nonsteroidal anti-inflammatory drugs, and the possible effects of nonsteroidal anti-inflammatory drugs on β-endorphin. J Clin Anesth. 2017 Feb;37:123-128. [Content Brief]

Complete Stock Solution Preparation Table

Optional Solvent	Concentration Solvent Mass	1 mg	5 mg	10 mg	25 mg

H₂O / DMSO	1 mM	0.2886 mL	1.4430 mL	2.8860 mL	7.2150 mL
	5 mM	0.0577 mL	0.2886 mL	0.5772 mL	1.4430 mL
	10 mM	0.0289 mL	0.1443 mL	0.2886 mL	0.7215 mL
DMSO	15 mM	0.0192 mL	0.0962 mL	0.1924 mL	0.4810 mL
	20 mM	0.0144 mL	0.0722 mL	0.1443 mL	0.3608 mL
	25 mM	0.0115 mL	0.0577 mL	0.1154 mL	0.2886 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.