1. GPCR/G Protein
  2. PACAP Receptor
  3. [Arg-15,20,21,Leu17]-PACAP-Gly-Lys-Arg-NH2

[Arg-15,20,21,Leu17]-PACAP-Gly-Lys-Arg-NH2  (Synonyms: BM-PACAP)

Cat. No.: HY-P3875
Handling Instructions Technical Support

[Arg-15,-20,-21,Leu17]-PACAP-Gly-Lys-Arg-NH2 (BM-PACAP) is a synthetic PACAP 1-27 (HY-P0176) analogue with relaxant effect.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Custom Peptide Synthesis

[Arg-15,20,21,Leu17]-PACAP-Gly-Lys-Arg-NH2

[Arg-15,20,21,Leu17]-PACAP-Gly-Lys-Arg-NH2 화학구조

CAS No. : 176785-25-4

사이즈 재고
50 mg   견적 받기  
100 mg   견적 받기  
250 mg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

This product is a controlled substance and not for sale in your territory.

Top Publications Citing Use of Products

View All PACAP Receptor Isoform Specific Products:

  • Biological Activity

  • 순도&문서

  • References

  • 고객리뷰

제품 설명

[Arg-15,-20,-21,Leu17]-PACAP-Gly-Lys-Arg-NH2 (BM-PACAP) is a synthetic PACAP 1-27 (HY-P0176) analogue with relaxant effect[1].

In Vitro

[Arg-15,-20,-21,Leu17]-PACAP-Gly-Lys-Arg-NH2 (BM-PACAP) (0.1 μM; 0-5 h) causes longer acting smooth-muscle relaxation than does the original PACAP 1-27 in human bronchi in vitro[1].
[Arg-15,-20,-21,Leu17]-PACAP-Gly-Lys-Arg-NH2 (0.3-3 μM; 0-6 h) causes concentration-dependent relaxation with a very similar maximum relaxant effect and potency in the guinea-pig trachea[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

분자량

3555.02

화학식

C157H253N53O42

CAS No.
Sequence Shortening

HSDGIFTDSYSRYRRQLAVRRYLAAVLGKR-NH2

선적

Room temperature in continental US; may vary elsewhere.

보관

Please store the product under the recommended conditions in the Certificate of Analysis.

용액&용해도
In Vitro: 

H2O

Peptide Solubility and Storage Guidelines:

1.  Calculate the length of the peptide.

2.  Calculate the overall charge of the entire peptide according to the following table:

  Contents Assign value
Acidic amino acid Asp (D), Glu (E), and the C-terminal -COOH. -1
Basic amino acid Arg (R), Lys (K), His (H), and the N-terminal -NH2 +1
Neutral amino acid Gly (G), Ala (A), Leu (L), Ile (I), Val (V), Cys (C), Met (M), Thr (T), Ser (S), Phe (F), Tyr (Y), Trp (W), Pro (P), Asn (N), Gln (Q) 0

3.  Recommended solution:

Overall charge of peptide Details
Negative (<0) 1.  Try to dissolve the peptide in water first.
2.  If water fails, add NH4OH (<50 μL).
3.  If the peptide still does not dissolve, add DMSO (50-100 μL) to solubilize the peptide.
Positive (>0) 1.  Try to dissolve the peptide in water first.
2.  If water fails, try dissolving the peptide in a 10%-30% acetic acid solution.
3.  If the peptide still does not dissolve, try dissolving the peptide in a small amount of DMSO.
Zero (=0) 1.  Try to dissolve the peptide in organic solvent (acetonitrile, methanol, etc.) first.
2.  For very hydrophobic peptides, try dissolving the peptide in a small amount of DMSO, and then dilute the solution with water to the desired concentration.
순도&문서
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • 몰농도 계산기

  • 농도 희석 계산기

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

상품명

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
[Arg-15,20,21,Leu17]-PACAP-Gly-Lys-Arg-NH2
Cat. No.:
HY-P3875
수량:
MCE Japan Authorized Agent: