2. GPCR/G Protein
  3. GCGR
  4. Beinaglutide

Beinaglutide is a human GLP-1 polypeptide that shares almost 100% homology with human GLP-1 (7–36). Beinaglutide displays does-dependent effects in glycemic control, inhibiting food intake and gastric empty and promoting weight loss. Beinaglutide has the potential for the research of overweight/obesity and nonalcoholic steatohepatitis (NASH).

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

Synthèse de peptides personnalisée

Beinaglutide

Beinaglutide Chemical Structure

CAS No. : 123475-27-4

Size Prix Stock Quantité
5 mg En stock
10 mg En stock
50 mg   Obtenir un devis  
100 mg   Obtenir un devis  

* Veuillez sélectionner la quantité avant d'ajouter des articles.

This product is a controlled substance and not for sale in your territory.

Avis client

Based on 1 publication(s) in Google Scholar

Beinaglutide Related Antibodies

Top Publications Citing Use of Products

1 Publications Citing Use of MCE Beinaglutide

  • Activité biologique

  • Pureté et documentation

  • Références

  • Avis client

Description

Beinaglutide is a human GLP-1 polypeptide that shares almost 100% homology with human GLP-1 (7–36). Beinaglutide displays does-dependent effects in glycemic control, inhibiting food intake and gastric empty and promoting weight loss. Beinaglutide has the potential for the research of overweight/obesity and nonalcoholic steatohepatitis (NASH)[1][2].

In Vitro

Beinaglutide (100 nM; 48 h) increases the expression of phosphorylation of Akt in the adipocytes that were potentiated insulin-stimulated[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Beinaglutide Related Antibodies

Western Blot Analysis[2]

Cell Line: 3T3L-1 cells
Concentration: 100 nM
Incubation Time: 48 h
Result: Increased the phosphorylation of Akt in the adipocytes that were potentiated insulin-stimulated.
In Vivo

Beinaglutide (0.6, 1.2, 2.4 mg/kg; s.c.; three times per day for 7 consecutive days) shows the ability of glycemic contro, inhibits food intake and weight loss in mouse[1].
Beinaglutide (150 μg/kg; s.c.; daily for 6 weeks) increases insulin sensitivity of adipocytes[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Wild-type male C57BL/6 mice and Male Lepob/Lepob (ob/ob) mice (ob/ob-NASH mouse model was induced by GAN diet)[1]
Dosage: 0.6, 1.2, 2.4 mg/kg
Administration: S.c.; three times per day for 7 consecutive days
Result: Significantly reduced blood glucose with dosedependence in C57BL/6 and ob/ob mice, dose dependently inhibits food intake and gastric Emptying, and significantly reduced body weight, food intake with dose-dependence.
Animal Model: Eight-week-old male C57BL/6 mice[2]
Dosage: 150 µg/kg
Administration: S.c.; daily for 6 weeks
Result: Showed improved glucose tolerance and insulin sensitivity, decreased adipose tissue weight and adipocyte size and potentiated insulin sensitivity of adipocytes.
Essai clinique
Masse moléculaire

3298.61

Formule

C149H225N39O46
CAS No.
Appearance

Solid

Color

White to off-white

Sequence Shortening

HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
Livraison

Room temperature in continental US; may vary elsewhere.
Stockage

Sealed storage, away from moisture and light, under nitrogen

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

Solvant et solubilité
In Vitro: 

DMSO : 1.79 mg/mL (0.54 mM; ultrasonic and adjust pH to 5 with HCl; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

  • Calculateur de molarité

  • Calculateur de dilution

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
Pureté et documentation
Références
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

Beinaglutide Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

Beinaglutide123475-27-4GLP-1 (human)GCGRGlucagon Receptorglycemic controlfood intakegastric emptyweight lossNASHAktInhibitorinhibitorinhibit

Vos produits récemment consultés:

Demande en ligne

Your information is safe with us. * Required Fields.

Nom du produit

  

Requested Quantity *

Nom du demandeur *

 

Civilité

Adresse e-mail *

 

Numéro de téléphone *

Department

 

Nom de l'organisation *

City

État

Country or Region *

      

Remarques

Bulk Inquiry

Inquiry Information

Nom du produit:
Beinaglutide
Cat. No.:
HY-P3463
Quantité:
MCE Japan Authorized Agent:

Avis client

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Nom du produit

  

Lot #

Nom du demandeur *

 

Adresse e-mail *

Numéro de téléphone

 

Department *

Nom de l'organisation *

 

Country or Region *

Remarques

SAFETY DATA SHEET (SDS)

English - EN (252 KB) Français - FR (252 KB) Deutsch - DE (252 KB) Norwegian - NO (252 KB) Español - ES (252 KB) Swedish - SV (252 KB) Italian - IT (252 KB) Korean - KR (252 KB) Portuguese - PT (252 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.