1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3) Cathepsin
  4. Cathepsin S
  5. Cathepsin S Protein, Human (HEK293, His)

Cathepsin S Protein, Human (HEK293, His) is potent cysteine protease which can promote degradation of damaged or unwanted proteins in the endo-lysosomal pathway.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Cathepsin S Protein, Human (HEK293, His) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Cathepsin S Protein, Human (HEK293, His) is potent cysteine protease which can promote degradation of damaged or unwanted proteins in the endo-lysosomal pathway.

Background

Cathepsin S is a member of the cysteine cathepsin protease family. Cathepsin S has specific roles such as MHC class II antigen presentation, where it is important in the degradation of the invariant chain. Cathepsin S is involved in a variety of pathological processes including arthritis, cancer, and cardiovascular disease, where it becomes secreted and can act on extracellular substrates. Cathepsin S has uniquely restricted tissue expression and is more stable at a neutral pH. Cathepsin S is unique amongst the cysteine cathepsin family due to restricted tissue expression, associated with antigen presenting cells localised in lymph and spleen, as well as other immune cells such as macrophages. Cathepsin S is thought to be a particularly potent cysteine protease cleaving elastin and generating bioactive elastin peptides, leading to the promotion of cardiovascular inflammation and calcification. Cathepsin S is also released by smooth muscle cells and macrophages as a systemic response to inflammation in a continuous recursive feedback loop[1][2].

Biological Activity

Measured by its ability to cleave a fluorogenic peptide substrate, (7-methoxycoumarin-4-yl) acetyl-Arg-Pro-Lys-Pro-Val-Glu-Nva-Trp-Arg-Lys (2, 4-dinitrophenyl)-NH2 (R&D Systems, Catalog#ES002). Cleavage of ES002 can be measured using excitation and emission wavelength at 320 nm and 405 nm, respectively.The specific activity is >300 pmoles/min/μg. (Activation description: The enzyme needs to be activated in acid buffer for an activated form.)

Assay Procedure

Materials
Assay buffer:50 mM NaOAc, 5 mM DTT, 250 mM NaCl, pH 4.5. Test protein: Cathepsin S Protein, Human (HEK293, His) (HY-P7756)
Substrate: (7-methoxycoumarin-4-yl) acetyl-Arg-Pro-Lys-Pro-Val-Glu-Nva-Trp-Arg-Lys (2, 4-dinitrophenyl)-NH2
Standard: MCA-Pro-Leu-OH

Procedure
1. Dilute Human Cathepsin S to 100 μg/mL in assay buffer.
2. Incubate at room temperature for 2 hours.
3. Dilute Human Cathepsin S to 2 ng/μL in assay buffer.
4. Dilute Substrate to 20 μM in assay buffer.
5. Load 50 μL of the 2 ng/μL Human Cathepsin S into a black well plate, and start the reaction by adding 50 μL of 20 μM substrate. Include a Substrate Blan k containing 50 μL assay buffer and 50 μL of 20 μM.
Substrate without any rh Cathepsin S.
6. Read at excitation and emission wavelengths of 320 nm and 405 nm (top read), respectively, in kinetic mode for 5 minutes.
7. Prepare a curve of standard MCA-Pro-Leu-OH in assay buffer. Make the following serial dilutions: 4 μM, 2 μM, 1 μM, 0.5 μM, 0.25 μM, 0.125 μM, 0.0625 μM mM and 0 μM. Then transfer 100 μL serial standards to the plate.
8. Read at excitation and emission wavelengths of 320 nm and 405 nm (top read), respectively, in endpoint mode.
9. Calculate the specific activity:

Specific Activity (pmol/min/μg) =
Adjusted Vmax (RFU/min) × Conversion Factor (pmol/RFU)
amount of enzyme (μg)

*Adjusted for Control
**Derived using calibration standard

Species

Human

Source

HEK293

Tag

C-His

Accession

NP_004070.3 (Q17-I331)

Gene ID
Molecular Construction
N-term
Cathepsin S (Q17-I331)
Accession # NP_004070.3
6*His
C-term
Protein Length

Full Length of Mature Protein (with Propeptide)

Synonyms
rHuCathepsin S, His; Cathepsin S; CTSS
AA Sequence

QLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQWQRNITYKSNPNRILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI

Predicted Molecular Mass
37 kDa
Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

1. Supplied as a 0.2 μm filter solution of 20 mM MES, 150 mM NaCl, 10% Glycerol, pH 5.5.
2. Supplied as a 0.2 μm filter solution of 12.5 mM MES, 75 mM NaCl, 10% Glycerol, 400 nM Leupeptin, 16 nM Aproteinin, pH 6.5.
3. Supplied as a 0.2 μm filter solution of 12.5 mM MES, 75 mM NaCl, pH 6.5 with 50% glycerol.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
References

Cathepsin S Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Cathepsin S Protein, Human (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Cathepsin S Protein, Human (HEK293, His)
Cat. No.:
HY-P7756
Quantity:
MCE Japan Authorized Agent: