1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3) Cathepsin
  4. Cathepsin S
  5. Cathepsin S Protein, Mouse (HEK293, His)

Cathepsin S Protein, Mouse (HEK293, His) is potent cysteine protease which can promote degradation of damaged or unwanted proteins in the endo-lysosomal pathway.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
Muestra gratis   Apply now
5 μg En stock
10 μg En stock
50 μg En stock
100 μg En stock
> 100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Cathepsin S Protein, Mouse (HEK293, His) Recomendaciones destacadas:

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

  • Referencias

Descripciòn

Cathepsin S Protein, Mouse (HEK293, His) is potent cysteine protease which can promote degradation of damaged or unwanted proteins in the endo-lysosomal pathway.

Background

Cathepsin S is a member of the cysteine cathepsin protease family. Cathepsin S has specific roles such as MHC class II antigen presentation, where it is important in the degradation of the invariant chain. Cathepsin S is involved in a variety of pathological processes including arthritis, cancer, and cardiovascular disease, where it becomes secreted and can act on extracellular substrates. Cathepsin S has uniquely restricted tissue expression and is more stable at a neutral pH. Cathepsin S is unique amongst the cysteine cathepsin family due to restricted tissue expression, associated with antigen presenting cells localised in lymph and spleen, as well as other immune cells such as macrophages. Cathepsin S is thought to be a particularly potent cysteine protease cleaving elastin and generating bioactive elastin peptides, leading to the promotion of cardiovascular inflammation and calcification. Cathepsin S is also released by smooth muscle cells and macrophages as a systemic response to inflammation in a continuous recursive feedback loop[1][2].

Actividad biológica

Measured by its ability to cleave the fluorogenic peptide substrate Mca-RPKPVE-Nval-WRK(Dnp)-NH2 (HY-P2185A) incubated at room temperature in kinetic mode for 5 minutes. Read at excitation and emission wavelengths of 320 nm and 405 nm. The specific activity is >300 pmol/min/µg.(Activation description: The enzyme needs to be activated in acid buffer for an activated form.)

  • Measured by its ability to cleave the fluorogenic peptide substrate Mca-RPKPVE-Nval-WRK(Dnp)-NH2. Read at excitation and emission wavelengths of 320 nm and 405 nm. The specific activity is 17654.2954 pmol/min/µg, as measured under the described conditions.
Assay Procedure

Materials
Assay buffer: 50 mM NaOAc,5 mM DTT, 250 mM NaCl, pH 4.5
Test protein: Cathepsin S Protein, Mouse (HEK293, His) (HY-P7757)
Substrate: NFF-3 TFA (HY-P2185A)
Standard: MCA-Pro-Leu-OH

Procedure
1. Dilute the standard with the assay buffer to the following concentrations: 0, 0.5, 1, 2, 3.9, 7.8, 15.6, 31.25, 62.5, 125, 250, and 500 μmol/L. Add 100 μL of each concentration to the wells to initiate the reaction, with three replicate wells for each concentration. Read the reaction in kinetic mode for 5 minutes at excitation and emission wavelengths of 320 nm and 405 nm, respectively. Plot the standard curve with the standard concentration as the x-axis and the measured RFU as the y-axis to obtain the standard curve equation.
2. First, reconstitute the protein to a concentration of 200 μg/mL with sterile water, then dilute Mouse Cathepsin S to 10 μg/mL with the assay buffer.
3. Incubate at room temperature for 2 hours.
4. Dilute Mouse Cathepsin S to 0.5 ng/μL with the assay buffer.
5. Dilute the substrate to 20 μM in assay buffer.
6. Add 50 μL of 0.5 ng/μL Mouse Cathepsin S and 50 μL of 20 μM substrate into a 96-well black plate. Include a substrate blank containing 50 μL of assay buffer and 50 μL of 20 μM substrate without any Mouse Cathepsin S. Perform each concentration in triplicate.
7. Read the RFU values in kinetic mode at excitation and emission wavelengths of 320 nm and 405 nm, respectively, for 5 minutes.
8. Calculate the specific activity:
Calculate the specific activity:

Specific Activity (pmol/min/μg) =
Adjusted Vmax (RFU/min) × Conversion Factor (pmol/RFU)
amount of enzyme (μg)

*Adjusted for Control
**Derived using calibration standard

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

O70370 (V18-I340)

Gene ID
Molecular Construction
N-term
Cathepsin S (V18-I340)
Accession # O70370
6*His
C-term
Protein Length

Full Length of Mature Protein (with Propeptide)

Synonyms
rMuCathepsin S, His; Cathepsin S; CTSS
AA Sequence

VCSVAMEQLQRDPTLDYHWDLWKKTHEKEYKDKNEEEVRRLIWEKNLKFIMIHNLEYSMGMHTYQVGMNDMGDMTNEEILCRMGALRIPRQSPKTVTFRSYSNRTLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKATDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEI

Peso molecular

Approximately 37-42 & 29-34 & 14 kDa, due to the glycosylation.

Glycosylation
Yes
Pureza
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Documentación
Referencias

Cathepsin S Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

Cathepsin S Protein, Mouse (HEK293, His)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
Cathepsin S Protein, Mouse (HEK293, His)
Cat. No.:
HY-P7757
Cantidad:
MCE Japan Authorized Agent: