1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. EGF Superfamily
  4. Neuregulins
  5. Neuregulin-3 (NRG3)
  6. Neuregulin-3/NRG3 Protein, Human (61a.a, HEK293, His, solution)

Neuregulin-3/NRG3 Protein, Human (61a.a, HEK293, His, solution)

Cat. No.: HY-P75944
Handling Instructions Technical Support

Neuregulin-3/NRG3 proteins are important members of the neuregulin family that influence cell signaling and development and contribute to a variety of biological processes. Their unique structural features, lacking conserved residues critical for feature annotation propagation, suggest different regulatory mechanisms or interactions. Neuregulin-3/NRG3 Protein, Human (61a.a, HEK293, His) is the recombinant human-derived Neuregulin-3/NRG3 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Neuregulin-3/NRG3 proteins are important members of the neuregulin family that influence cell signaling and development and contribute to a variety of biological processes. Their unique structural features, lacking conserved residues critical for feature annotation propagation, suggest different regulatory mechanisms or interactions. Neuregulin-3/NRG3 Protein, Human (61a.a, HEK293, His) is the recombinant human-derived Neuregulin-3/NRG3 protein, expressed by HEK293 , with C-His labeled tag.

Background

The Neuregulin-3/NRG3 Protein is a member of the neuregulin family, playing a significant role in cellular signaling and development. As part of this family, NRG3 contributes to diverse biological processes, including cell growth, differentiation, and tissue development. Notably, the protein lacks conserved residue(s) crucial for the propagation of feature annotation, suggesting unique structural characteristics or functional properties within the neuregulin family. The absence of these conserved residues may hint at distinct regulatory mechanisms or interactions specific to NRG3, warranting further investigation into its precise role in cellular signaling and its potential implications in various physiological contexts.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Human Neuregulin-3/NRG3 at 2 μg/mL (100 μL/well) can bind Human ErbB4/Her4 (HY-P73035). The ED50 for this effect is 15.67 ng/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Human Neuregulin-3/NRG3 at 2 μg/mL (100 μL/well) can bind Human ErbB4/Her4 (HY-P73035). The ED50 for this effect is 15.67 ng/mL.
Species

Human

Source

HEK293

Tag

C-10*His

Accession

B9EGV5 (E282-P342)

Gene ID
Molecular Construction
N-term
NRG3 (E282-P342)
Accession # B9EGV5
10*His
C-term
Protein Length

Partial

Synonyms
Pro-NRG3; Neuregulin-3; NRG-3; NRG3
AA Sequence

ERSEHFKPCRDKDLAYCLNDGECFVIETLTGSHKHCRCKEGYQGVRCDQFLPKTDSILSDP

Predicted Molecular Mass
8.5 kDa
Molecular Weight

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
References

Neuregulin-3/NRG3 Protein, Human (61a.a, HEK293, His, solution) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Neuregulin-3/NRG3 Protein, Human (61a.a, HEK293, His, solution)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Neuregulin-3/NRG3 Protein, Human (61a.a, HEK293, His, solution)
Cat. No.:
HY-P75944
Quantity:
MCE Japan Authorized Agent: