1. GPCR/G Protein
  2. Protease-Activated Receptor (PAR)
  3. Parstatin(human)

Parstatin(human) 

Cat. No.: HY-P1262
Handling Instructions

Parstatin(human), a cell-penetrating PAR-1 thrombin receptor agonist peptide, is a potent inhibitor of angiogenesis.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Parstatin(human) Chemical Structure

Parstatin(human) Chemical Structure

CAS No. : 1065755-99-8

Size Stock
100 mg   Get quote  
250 mg   Get quote  
500 mg   Get quote  

* Please select Quantity before adding items.

Other Forms of Parstatin(human):

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Parstatin(human), a cell-penetrating PAR-1 thrombin receptor agonist peptide, is a potent inhibitor of angiogenesis[1][2].

In Vitro

Parstatin (0-10 µM) increases recovery of LVDP in a concentration-dependent manner. The optimal concentration was 1 µM which produced a 23% recovery of LVDP[2].

In Vivo

Parstatin (single dose, 1-25 µg/kg, iv) administered prior to ischaemia confers immediate cardioprotection by recruiting the Gi-protein activation pathway including p38 MAPK, ERK1/2, NOS, and KATP channels. Parstatin exerts effects on both the cardiomyocytes and the coronary circulation to induce cardioprotection. This suggests a potential therapeutic role of parstatin in the treatment of cardiac injury resulting from ischaemia and reperfusion[1].

Animal Model: Male Sprague–Dawley rats at 8 weeks of age (250-300 g)[1].
Dosage: 1-25 µg/kg.
Administration: IV injected 15 min prior to ischaemia.
Result: A significant decrease in infarct size was detected with the 5-15 µg/kg doses with 10 µg/kg as the optimal dose. These hearts had an infarct size of 46 ± 3% of the area at risk, which is a 26% reduction in infarct size compared with the control.
Molecular Weight

4467.26

Formula

C₁₉₁H₃₃₀N₆₄O₅₃S₃

CAS No.

1065755-99-8

Sequence

{Met}{Gly}{Pro}{Arg}{Arg}{Leu}{Leu}{Leu}{Val}{Ala}{Ala}{Cys}{Phe}{Ser}{Leu}{Cys}{Gly}{Pro}{Leu}{Leu}{Ser}{Ala}{Arg}{Thr}{Arg}{Ala}{Arg}{Arg}{Pro}{Glu}{Ser}{Lys}{Ala}{Thr}{Asn}{Ala}{Thr}{Leu}{Asp}{Pro}{Arg}

Sequence Shortening

MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPR

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Solvent & Solubility
In Vitro: 

H2O

Peptide Solubility and Storage Guidelines:

1.  Calculate the length of the peptide.

2.  Calculate the overall charge of the entire peptide according to the following table:

  Contents Assign value
Acidic amino acid Asp (D), Glu (E), and the C-terminal -COOH. -1
Basic amino acid Arg (R), Lys (K), His (H), and the N-terminal -NH2 +1
Neutral amino acid Gly (G), Ala (A), Leu (L), Ile (I), Val (V), Cys (C), Met (M), Thr (T), Ser (S), Phe (F), Tyr (Y), Trp (W), Pro (P), Asn (N), Gln (Q) 0

3.  Recommended solution:

Overall charge of peptide Details
Negative (<0) 1.  Try to dissolve the peptide in water first.
2.  If water fails, add NH4OH (<50 μL).
3.  If the peptide still does not dissolve, add DMSO (50-100 μL) to solubilize the peptide.
Positive (>0) 1.  Try to dissolve the peptide in water first.
2.  If water fails, try dissolving the peptide in a 10%-30% acetic acid solution.
3.  If the peptide still does not dissolve, try dissolving the peptide in a small amount of DMSO.
Zero (=0) 1.  Try to dissolve the peptide in organic solvent (acetonitrile, methanol, etc.) first.
2.  For very hydrophobic peptides, try dissolving the peptide in a small amount of DMSO, and then dilute the solution with water to the desired concentration.
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Keywords:

Parstatin(human)Protease-Activated Receptor (PAR)Thrombin receptorsInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product name:
Parstatin(human)
Cat. No.:
HY-P1262
Quantity:
MCE Japan Authorized Agent: