1065755-99-8
Chemical Structure
Parstatin(human)
- CAS No.: 1065755-99-8
- Formula:C191H330N64O53S3
- Molecular Weight:4467.26
SMILES: [MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPR]
Biological Activity: Parstatin(human), a cell-penetrating PAR-1 thrombin receptor agonist peptide, is a potent inhibitor of angiogenesis[1][2].
| Cat. No. | Product Name | Purity | Description | Pricing | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
|
Parstatin(human) | Parstatin(human), a cell-penetrating PAR-1 thrombin receptor agonist peptide, is a potent inhibitor of angiogenesis. | |||||||||||||||||||||
|
loading...
/
|
|||||||||||||||||||||||
References
- [1]. Panagiota Zania, et al. Parstatin, the Cleaved Peptide on Proteinase-Activated Receptor 1 Activation, Is a Potent Inhibitor of Angiogenesis. J Pharmacol Exp Ther. 2009 Feb;328(2):378-89. [Content Brief]
- [2]. Jennifer L Strande, et al. Parstatin: A Cryptic Peptide Involved in Cardioprotection After Ischaemia and Reperfusion Injury. Cardiovasc Res. 2009 Jul 15;83(2):325-34. [Content Brief]