Peptide YY (pig)
Peptide YY (pig) is a 36 amino acid gastrointestinal peptide, can be isolated from porcine duodenum. Peptide YY (pig) decreases appetite and food-intake by activation of the Y2 receptor. Peptide YY (pig) is present mainly in pancreatic endocrine cells with effect on both intestinal motility and the cardiovascular system.
Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.
- CAS No.: 81858-94-8
- Formule: C190H288N54O57
- Masse moléculaire:4240.72
-
Stockage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Activité biologique
-
Chemical Information
- Pureté et documentation
- Références
-
Help & FAQs
Voir tous les produits spécifiques à Isoform Neuropeptide Y Receptor
More
Activité biologique
|
NPY Y2 receptor |
Peptide YY (pig) (10 μg/mL) has antibody specificity (for PYY antiserum), as well as human pancreatic polypeptide (PP). Both of them may play endocrine or paracrine roles in the regulation of islet hormone secretion in various vertebrate species[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Peptide YY1-36 (pig) shows other physiological effects including slowing of intestinal transit, inhibition of gastrointestinal anion and electrolyte secretion and lowering of blood glucose[3].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
CAS No. 81858-94-8
-
Masse moléculaire 4240.72
-
Formule C190H288N54O57
-
Sequence Shortening
YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2
-
Livraison
Room temperature in continental US; may vary elsewhere.
-
Stockage
Please store the product under the recommended conditions in the Certificate of Analysis.
Pureté et documentation
Références
[1]. Lundberg JM, et al. Localization of peptide YY (PYY) in gastrointestinal endocrine cells and effects on intestinal blood flow and motility. Proc Natl Acad Sci U S A. 1982 Jul;79(14):4471-5. [Content Brief]
[2]. Ding WG, et al. Neuropeptide Y and peptide YY immunoreactivities in the pancreas of various vertebrates. Peptides. 1997;18(10):1523-9. [Content Brief]
[3]. Olsen J, et al. Metabolism of peptide YY 3-36 in Göttingen mini-pig and rhesus monkey. Peptides. 2016 Apr;78:59-67. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Peptide YY (pig) Related Classifications
HY-P2703 Related Classifications
Powered by Bioz