Peptide YY (pig)
Peptide YY (pig) is a 36 amino acid gastrointestinal peptide, can be isolated from porcine duodenum. Peptide YY (pig) decreases appetite and food-intake by activation of the Y2 receptor. Peptide YY (pig) is present mainly in pancreatic endocrine cells with effect on both intestinal motility and the cardiovascular system.
For research use only. We do not sell to patients.
- CAS No.: 81858-94-8
- Formula: C190H288N54O57
- Molecular Weight:4240.72
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
-
Biological Activity
-
Chemical Information
- Purity & Documentation
- References
-
Help & FAQs
All Neuropeptide Y Receptor Isoforms
More
Biological Activity
|
NPY Y2 receptor |
Peptide YY (pig) (10 μg/mL) has antibody specificity (for PYY antiserum), as well as human pancreatic polypeptide (PP). Both of them may play endocrine or paracrine roles in the regulation of islet hormone secretion in various vertebrate species[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Peptide YY1-36 (pig) shows other physiological effects including slowing of intestinal transit, inhibition of gastrointestinal anion and electrolyte secretion and lowering of blood glucose[3].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
CAS No. 81858-94-8
-
Molecular Weight 4240.72
-
Formula C190H288N54O57
-
Sequence Shortening
YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
[1]. Lundberg JM, et al. Localization of peptide YY (PYY) in gastrointestinal endocrine cells and effects on intestinal blood flow and motility. Proc Natl Acad Sci U S A. 1982 Jul;79(14):4471-5. [Content Brief]
[2]. Ding WG, et al. Neuropeptide Y and peptide YY immunoreactivities in the pancreas of various vertebrates. Peptides. 1997;18(10):1523-9. [Content Brief]
[3]. Olsen J, et al. Metabolism of peptide YY 3-36 in Göttingen mini-pig and rhesus monkey. Peptides. 2016 Apr;78:59-67. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz