Peptide YY (pig) 

Peptide YY (pig) is a 36 amino acid gastrointestinal peptide, can be isolated from porcine duodenum. Peptide YY (pig) decreases appetite and food-intake by activation of the Y2 receptor. Peptide YY (pig) is present mainly in pancreatic endocrine cells with effect on both intestinal motility and the cardiovascular system^[1][2][3].

Peptide YY (pig) (10 μg/mL) has antibody specificity (for PYY antiserum), as well as human pancreatic polypeptide (PP). Both of them may play endocrine or paracrine roles in the regulation of islet hormone secretion in various vertebrate species^[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Peptide YY_1-36 (pig) is degraded to PYY_3-36 by dipeptidyl peptidase IV (DPP-IV), and PYY_3-36 (50 nmol/kg; i.v.; single dose) is further broken down into many metabolism in Göttingen mini-pig and Rhesus monkey^[3].
Peptide YY_1-36 (pig) shows other physiological effects including slowing of intestinal transit, inhibition of gastrointestinal anion and electrolyte secretion and lowering of blood glucose^[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

4240.72

C₁₉₀H₂₈₈N₅₄O₅₇

81858-94-8

YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2

Room temperature in continental US; may vary elsewhere.

Please store the product under the recommended conditions in the Certificate of Analysis.

• [1]. Lundberg JM, et al. Localization of peptide YY (PYY) in gastrointestinal endocrine cells and effects on intestinal blood flow and motility. Proc Natl Acad Sci U S A. 1982 Jul;79(14):4471-5.  [Content Brief]

  [2]. Ding WG, et al. Neuropeptide Y and peptide YY immunoreactivities in the pancreas of various vertebrates. Peptides. 1997;18(10):1523-9.  [Content Brief]

  [3]. Olsen J, et al. Metabolism of peptide YY 3-36 in Göttingen mini-pig and rhesus monkey. Peptides. 2016 Apr;78:59-67.  [Content Brief]