1. GPCR/G Protein
  2. GHSR
  3. GRF (1-29) amide (rat)

GRF (1-29) amide (rat)  (Synonyms: rGHRH(1-29)NH2)

Cat. No.: HY-P1155 Purity: 99.80%
Handling Instructions Technical Support

GRF (1-29) amide (rat) is a synthetic peptide which can stimulate the growth hormone (GH) secretion.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Custom Peptide Synthesis

GRF (1-29) amide (rat)

GRF (1-29) amide (rat) 화학구조

CAS No. : 91826-20-9

사이즈 가격 재고 수량
1 mg 해외재고보유
5 mg 해외재고보유
10 mg 해외재고보유
50 mg   견적 받기  
100 mg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

This product is a controlled substance and not for sale in your territory.

고객리뷰

Based on 1 publication(s) in Google Scholar

Top Publications Citing Use of Products

1 Publications Citing Use of MCE GRF (1-29) amide (rat)

View All GHSR Isoform Specific Products:

  • Biological Activity

  • Protocol

  • 순도&문서

  • References

  • 고객리뷰

제품 설명

GRF (1-29) amide (rat) is a synthetic peptide which can stimulate the growth hormone (GH) secretion.

In Vivo

Time course studies of GRF (1-29) amide (rat) disappearance show apparent half-lives of 18±4 min and 13±3 min in serum and liver homogenate, respectively. This is accompanied by the appearance of degradation products that are all less hydrophobic than the native peptide. In the serum, two major metabolites are detected and isolated by preparative HPLC[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

분자량

3473.08

화학식

C155H251N49O40S

CAS No.
Appearance

Solid

Color

White to off-white

Sequence

His-Ala-Asp-Ala-Ile-Phe-Thr-Ser-Ser-Tyr-Arg-Arg-Ile-Leu-Gly-Gln-Leu-Tyr-Ala-Arg-Lys-Leu-Leu-His-Glu-Ile-Met-Asn-Arg-NH2

Sequence Shortening

HADAIFTSSYRRILGQLYARKLLHEIMNR-NH2

선적

Room temperature in continental US; may vary elsewhere.

보관

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

용액&용해도
In Vitro: 

H2O : 16.67 mg/mL (4.80 mM; Need ultrasonic)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2879 mL 1.4396 mL 2.8793 mL
5 mM --- --- ---
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • 몰농도 계산기

  • 농도 희석 계산기

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
순도&문서

Purity: 99.80%

References
Cell Assay 
[1]

To isolate GRF metabolites in the liver, rGRF(1-29)NH2 (10 mg) is first preincubated in 232 mL of Krebs' buffer (5 min, 37°C) to help GRF solubilization and then incubated with a liver homogenate in a shaking bath at 37°C. The homogenate is prepared as in the degradation assays with 580 mg of liver (10 mg/mL). The reaction is stopped after 30 min by adding 174 mL of cold 50 mM phosphate solution (pH 0.8) and centrifugation (48,000×g, 20 min, 4°C). The supernatant is filtered twice and its pH is adjusted (3.0) with 6 N NaOH before chromatography. The GRF metabolites and residual rGRF(1-29)NH2 are isolated[1].

MCE 는 독립적으로 이러한 방법들의 정확성을 확인하지 않았습니다. 참고용으로만 봐주십시오.

References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
H2O 1 mM 0.2879 mL 1.4396 mL 2.8793 mL 7.1982 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

상품명

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
GRF (1-29) amide (rat)
Cat. No.:
HY-P1155
수량:
MCE Japan Authorized Agent: