14-3-3 beta Protein, Cynomolgus

14-3-3 beta proteins act as adapters, binding to phosphoserine or phosphothreonine motifs in different signaling pathways, regulating chaperone activity. It negatively regulates osteogenesis by blocking the nuclear translocation of phosphorylated SRPK2 and counteracting the pro-apoptotic effect of SRPK2 through cyclin D1 expression. 14-3-3 beta Protein, Cynomolgus is the recombinant cynomolgus-derived 14-3-3 beta protein, expressed by E. coli , with tag free.

14-3-3 beta protein serves as an adapter involved in the regulation of diverse signaling pathways, engaging with numerous partners through recognition of phosphoserine or phosphothreonine motifs. The resulting interactions typically modulate the activity of the binding partner. Functioning as a negative regulator of osteogenesis, it impedes the nuclear translocation of the phosphorylated form of SRPK2, counteracting SRPK2's stimulatory effect on cyclin D1 expression and thereby preventing neuronal apoptosis. Additionally, 14-3-3 beta negatively regulates signaling cascades that activate MAP kinases via AKAP13. Existing as a homodimer, it interacts with various proteins, including SAMSN1, PRKCE, AKAP13, SSH1, TORC2/CRTC2, ABL1, ROR2, GAB2, YAP1, SRPK2, AANAT, MYO1C, SIRT2, DAPK2, PI4KB, TBC1D22A, TBC1D22B, SOS1, SLITRK1, SYNPO2, RIPOR2, MARK2, MARK3, TESK1, MEFV, HDAC4, and ADAM22, participating in diverse cellular processes.

Cynomolgus

E. coli

Tag Free

Q4R572-2 (M1-N244)

101926442  [NCBI]

Full Length of Isoform-2

MDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, 10% Glycerol, 0.5 mM DTT, pH 7.5. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. /biology-dictionary/daoy-cell.html