14-3-3 beta Protein, Human (GST)
14-3-3 beta proteins serve as adapter proteins that regulate multiple signaling pathways by recognizing phosphoserine or phosphothreonine motifs and regulating chaperone activity. It acts as a negative regulator during osteogenesis, inhibiting nuclear translocation of SRPK2 and preventing neuronal apoptosis. 14-3-3 beta Protein, Human (GST) is the recombinant human-derived 14-3-3 beta protein, expressed by E. coli , with N-GST labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
14-3-3 beta proteins serve as adapter proteins that regulate multiple signaling pathways by recognizing phosphoserine or phosphothreonine motifs and regulating chaperone activity. It acts as a negative regulator during osteogenesis, inhibiting nuclear translocation of SRPK2 and preventing neuronal apoptosis. 14-3-3 beta Protein, Human (GST) is the recombinant human-derived 14-3-3 beta protein, expressed by E. coli , with N-GST labeled tag.
Background
The 14-3-3 beta protein serves as an adapter implicated in the regulation of a wide spectrum of both general and specialized signaling pathways. Recognizing phosphoserine or phosphothreonine motifs, it binds to numerous partners, modulating the activity of the binding partner upon interaction. It acts as a negative regulator of osteogenesis by blocking the nuclear translocation of the phosphorylated form of SRPK2, counteracting its stimulatory effect on cyclin D1 expression, and thereby preventing neuronal apoptosis induced by SRPK2. Additionally, 14-3-3 beta negatively regulates signaling cascades that activate MAP kinases through AKAP13. Existing as a homodimer, it interacts with various proteins, including SAMSN1, PRKCE, AKAP13, SSH1, TORC2/CRTC2, ABL1, ROR2, GAB2, YAP1, SRPK2, PKA-phosphorylated AANAT, MYO1C, SIRT2, DAPK2, PI4KB, TBC1D22A, TBC1D22B, SOS1, YWHAB, SLITRK1, SYNPO2, RIPOR2, MARK2, MARK3, TESK1, MEFV, HDAC4, and ADAM22. These interactions highlight the diverse roles of 14-3-3 beta in various cellular processes and signaling pathways.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-GST
-
Accession
P31946 (M1-N246)
-
Molecular Construction
-
N-term
-
GST
-
14-3-3β (M1-N246)
Accession # P31946 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
YWHAB; Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenase Activation Protein Beta; YWHAA; 14-3-3 Protein Beta/Alpha; Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenase Activation Protein; Alpha Polypeptide; Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxyg
-
AA Sequence
MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN
-
Predicted Molecular Mass
54.9 kDa
-
Molecular Weight
Approximately 52 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
