1. Recombinant Proteins
  2. Others
  3. 14-3-3 beta Protein, Human

14-3-3 beta proteins serve as adapter proteins that regulate multiple signaling pathways by recognizing phosphoserine or phosphothreonine motifs and regulating chaperone activity. It acts as a negative regulator during osteogenesis, inhibiting nuclear translocation of SRPK2 and preventing neuronal apoptosis. 14-3-3 beta Protein, Human is the recombinant human-derived 14-3-3 beta protein, expressed by E. coli , with tag free.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
50 μg En stock
100 μg En stock
> 100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

14-3-3 beta proteins serve as adapter proteins that regulate multiple signaling pathways by recognizing phosphoserine or phosphothreonine motifs and regulating chaperone activity. It acts as a negative regulator during osteogenesis, inhibiting nuclear translocation of SRPK2 and preventing neuronal apoptosis. 14-3-3 beta Protein, Human is the recombinant human-derived 14-3-3 beta protein, expressed by E. coli , with tag free.

Background

The 14-3-3 beta protein serves as an adapter implicated in the regulation of a wide spectrum of both general and specialized signaling pathways. Recognizing phosphoserine or phosphothreonine motifs, it binds to numerous partners, modulating the activity of the binding partner upon interaction. It acts as a negative regulator of osteogenesis by blocking the nuclear translocation of the phosphorylated form of SRPK2, counteracting its stimulatory effect on cyclin D1 expression, and thereby preventing neuronal apoptosis induced by SRPK2. Additionally, 14-3-3 beta negatively regulates signaling cascades that activate MAP kinases through AKAP13. Existing as a homodimer, it interacts with various proteins, including SAMSN1, PRKCE, AKAP13, SSH1, TORC2/CRTC2, ABL1, ROR2, GAB2, YAP1, SRPK2, PKA-phosphorylated AANAT, MYO1C, SIRT2, DAPK2, PI4KB, TBC1D22A, TBC1D22B, SOS1, YWHAB, SLITRK1, SYNPO2, RIPOR2, MARK2, MARK3, TESK1, MEFV, HDAC4, and ADAM22. These interactions highlight the diverse roles of 14-3-3 beta in various cellular processes and signaling pathways.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P31946 (M1-N246)

Gene ID
Molecular Construction
N-term
14-3-3β (M1-N246)
Accession # P31946
C-term
Protein Length

Full Length

Synonyms
KCIP-1; 14-3-3 protein beta/alpha; GW128; Protein 1054; YWHAB
AA Sequence

MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN

Predicted Molecular Mass
28 kDa
Peso molecular

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

Pureza

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 150 mM NaCl, 0.1 mM DTT, 10% Glycerol, pH 7.5, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Documentación

14-3-3 beta Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

14-3-3 beta Protein, Human

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
14-3-3 beta Protein, Human
Cat. No.:
HY-P74440
Cantidad:
MCE Japan Authorized Agent: