4-1BB/TNFRSF9 Protein, Human (HEK293, Fc)

4-1BB/TNFRSF9 Protein, Human (HEK293, Fc), a recombinant human 4-1BB/TNFRSF9 Protein produced in HEK293 cells, has an Fc fragment at the C-terminus. Recombinant Human 4-1BBRTNFRSF9, an inducible T cell molecule belonging to the TNF receptor superfamily, could promote the expansion of antigen-specific T cells and prevent activation-induced death of CD8⁺ T cells^[1].

Recombinant Human 4-1BB/TNFRSF9 (CD137) is an inducible T cell molecule belonging to the TNF receptor superfamily. It has been shown that signaling through CD137 by either its natural ligand, 4-1BBL, or by agonistic Ab’s costimulates activation of CD4⁺ and CD8⁺ T cells in a CD28-independent fashion, leading to activation of the NF-κB, c-Jun NH2-terminal kinase/stress-activated protein kinase (JNK/SAPK), and p38 signaling pathways. In addition to its role in promoting the expansion of antigen-specific T cells, CD137 signaling may also prevent activation-induced death of CD8⁺ T cells^[1].

4-1BB (human; 1 μg/mL; 16 h) leads to induction of monocyte activation and induces Myc protein production^[4].
4-1BB (human; 1 μg/mL; 1 d) prolongs survival of peripheral monocytes and (1 μg/mL; 1 h) induces expression of M-CSF^[5].
4-1BB (human; 1.2-4 μg/mL; 7 d) exhibits nhancement of cell numbers dose-dependently^[6].

Human

HEK293

C-hFc

Q07011 (L24-Q186)

3604  [NCBI]

Extracellular Domain

LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ

Approximately 58 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.

• [1]. Ye L, et al. CD137, an attractive candidate for the immunotherapy of lung cancer. Cancer Sci. 2020 May;111(5):1461-1467.  [Content Brief]

  [2]. Wilcox RA, et al. Provision of antigen and CD137 signaling breaks immunological ignorance, promoting regression of poorly immunogenic tumors. J Clin Invest. 2002 Mar;109(5):651-9.  [Content Brief]

  [3]. Jiang P, et al. CD137 promotes bone metastasis of breast cancer by enhancing the migration and osteoclast differentiation of monocytes/macrophages. Theranostics. 2019 May 9;9(10):2950-2966.  [Content Brief]

  [4]. Geng T, et al. CD137 Signaling Promotes Endothelial Apoptosis by Inhibiting Nrf2 Pathway, and Upregulating NF-κB Pathway. Mediators Inflamm. 2020 Jun 6;2020:4321912.  [Content Brief]

  [5]. Langstein J, et al. Comparative analysis of CD137 and LPS effects on monocyte activation, survival, and proliferation. Biochem Biophys Res Commun. 2000 Jun 24;273(1):117-22.  [Content Brief]

  [6]. Langstein J, et al. Identification of CD137 as a potent monocyte survival factor. J Leukoc Biol. 1999 Jun;65(6):829-33.  [Content Brief]

  [7]. Jiang D, et al. CD137 induces proliferation of murine hematopoietic progenitor cells and differentiation to macrophages. J Immunol. 2008 Sep 15;181(6):3923-32.  [Content Brief]