ACKR1 Protein, Human (Cell-Free, His)

ACKR3, an atypical chemokine receptor, modulates chemokine levels and localization by high-affinity binding, inducing sequestration, degradation, or transcytosis. Also known as a chemokine interceptor or decoy receptor, ACKR3 binds to chemokines like CXCL11 and CXCL12/SDF1. Unlike conventional signaling, ACKR3 triggers beta-arrestin recruitment, leading to ligand internalization and MAPK pathway activation. In interneurons, it regulates CXCR4 levels, adapting chemokine responsiveness. In glioma cells, it activates the MEK/ERK pathway, influencing growth and survival. While inactive in normal hematopoietic cells, ACKR3, activated by CXCL11 in malignant cells, enhances cell adhesion, migration, and acts as an HIV coreceptor. ACKR1 Protein, Human (Cell-Free, His) is the recombinant human-derived ACKR1 protein, expressed by E. coli Cell-free, with N-10*His labeled tag. The total length of ACKR1 Protein, Human (Cell-Free, His) is 336 a.a., with molecular weight of 41.1 kDa.

ACKR3, an atypical chemokine receptor, serves as a key regulator of chemokine levels and localization through high-affinity binding to chemokines, leading to chemokine sequestration, degradation, or transcytosis. Also referred to as an interceptor, chemokine-scavenging receptor, or chemokine decoy receptor, ACKR3 functions as a receptor for chemokines such as CXCL11 and CXCL12/SDF1. Unlike traditional ligand-driven signal transduction, chemokine binding to ACKR3 does not activate G-protein-mediated pathways but induces beta-arrestin recruitment, resulting in ligand internalization and activation of the MAPK signaling pathway. ACKR3 plays a crucial role in regulating CXCR4 protein levels in migrating interneurons, adapting their chemokine responsiveness. In glioma cells, it transduces signals through the MEK/ERK pathway, contributing to cell growth and survival. While not involved in normal hematopoietic progenitor cell functions, ACKR3 is activated by CXCL11 in malignant hematopoietic cells, leading to ERK1/2 phosphorylation, enhanced cell adhesion, and migration. Additionally, ACKR3 acts as a coreceptor with CXCR4 for a limited subset of HIV isolates, highlighting its involvement in microbial infection.

Human

E. coli Cell-free

N-10*His

Q16570 (M1-S336)

2532  [NCBI]

MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWSSHLDTLGSKS

41.1 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.