ACKR1 Protein, Human (Cell-Free, His)

Customer Review

Based on 1 Customer Validation

ACKR3 is an atypical chemokine receptor that regulates chemokine levels and localization through high-affinity binding, induction of sequestration, degradation, or transcytosis. ACKR3, also known as a chemokine interceptor or decoy receptor, binds to chemokines such as CXCL11 and CXCL12/SDF1. ACKR1 Protein, Human (Cell-Free, His) is the recombinant human-derived ACKR1 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli Cell-free
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

ACKR3 is an atypical chemokine receptor that regulates chemokine levels and localization through high-affinity binding, induction of sequestration, degradation, or transcytosis. ACKR3, also known as a chemokine interceptor or decoy receptor, binds to chemokines such as CXCL11 and CXCL12/SDF1. ACKR1 Protein, Human (Cell-Free, His) is the recombinant human-derived ACKR1 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

Background

ACKR3, an atypical chemokine receptor, serves as a key regulator of chemokine levels and localization through high-affinity binding to chemokines, leading to chemokine sequestration, degradation, or transcytosis. Also referred to as an interceptor, chemokine-scavenging receptor, or chemokine decoy receptor, ACKR3 functions as a receptor for chemokines such as CXCL11 and CXCL12/SDF1. Unlike traditional ligand-driven signal transduction, chemokine binding to ACKR3 does not activate G-protein-mediated pathways but induces beta-arrestin recruitment, resulting in ligand internalization and activation of the MAPK signaling pathway. ACKR3 plays a crucial role in regulating CXCR4 protein levels in migrating interneurons, adapting their chemokine responsiveness. In glioma cells, it transduces signals through the MEK/ERK pathway, contributing to cell growth and survival. While not involved in normal hematopoietic progenitor cell functions, ACKR3 is activated by CXCL11 in malignant hematopoietic cells, leading to ERK1/2 phosphorylation, enhanced cell adhesion, and migration. Additionally, ACKR3 acts as a coreceptor with CXCR4 for a limited subset of HIV isolates, highlighting its involvement in microbial infection.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized ACKR1 at 0.2 μg/well can bind human CCL2, the ED50 of human CCL2 protein is ≤70 μg/mL.

Technical Parameters

  • Species Human
  • Source E. coli Cell-free
  • Tag N-10*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 10*His
    • ACKR1 (M1-S336)
      Accession # Q16570-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    ACKR1; Duffy Blood Group Antigen; Prev. DARC; Fy Glycoprotein; Prev. FY; GpFy; Atypical Chemokine Receptor 1; Solute Carrier Family 29 Member 1 (Augustine Blood Group); GPD; Duffy Blood Group, Atypical Chemokine Receptor; Glycoprotein D; Duffy Antigen Che

  • AA Sequence

    MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWSSHLDTLGSKS

  • Predicted Molecular Mass

    41.1 kDa

  • Molecular Weight

    Approximately 42 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 85%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.15 M NaCl, 0.05% FOS12, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00