ACVR1 Protein, Mouse (HEK293, His-hFc)
Activin A receptor, type I (ACVR1), also known as ALK-2, is a bone morphogenetic protein (BMP) type I receptor. ACVR1 is involved in a wide variety of biological processes, including bone, heart, cartilage, nervous, and reproductive system development and regulation. ACVR1 Protein, Mouse (HEK293, His-hFc) is produced in HEK293 cells with a C-Terminal His-tag and a C-Terminal Fc-tag . It consists of 123 amino acids (M1-E123).
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
Activin A receptor, type I (ACVR1), also known as ALK-2, is a bone morphogenetic protein (BMP) type I receptor. ACVR1 is involved in a wide variety of biological processes, including bone, heart, cartilage, nervous, and reproductive system development and regulation[1]. ACVR1 Protein, Mouse (HEK293, His-hFc) is produced in HEK293 cells with a C-Terminal His-tag and a C-Terminal Fc-tag . It consists of 123 amino acids (M1-E123).
Background
Activin A receptor type I (ACVR1) gene, also known as ALK-2, is located in chromosome 2q23-q24 and encodes for the 509 amino acid protein. The ACVR1 protein product is initially described as an activin type I receptor, and it is found to be expressed in several tissues and different human cell lines[1].
The sequence of amino acids in ACVR1 proteins from different species is very stable, which leads to the conclusion that in the process of evolution, ACVR1 has been only slightly altered, and that both in humans and in animals, its function is similar.
As a member of the BMP/TGFβ receptor family, the ACVR1 protein contains an extracellular N-terminal ligand-binding domain, a transmembrane (TM) domain, an intracellular glycine-serine-rich (GS) domain, and a protein kinase (PK) domain. The loop positioned in the helix-loop-helix of the GS domain contains the key residues responsible for ACVR1 activation upon phosphorylation. As a type I receptor, ACVR1 forms heterotetrameric receptor complexes with the type II receptors BMPR2, ACVR2A, and ACVR2B. Such complexes consist of two type I and two type II receptors. Upon binding of ligands to the heteromeric complexes, type II receptors transphosphorylate the GS domain of type I receptors. As a result, the kinase domain of type I receptors is activated and subsequently phosphorylates SMAD1/5/8 proteins that transduce the signal. ACVR1 is first described to bind to activin A, a member of the BMP/TGFβ family that usually triggers phosphorylation and activation of SMAD2/3 upon complex formation with type II receptors. Later, ACVR1 is also found to bind several BMPs with distinct affinities, triggering SMAD1/5/8 signalling. Besides canonical SMAD signalling, ACVR1 can activate non-canonical signalling pathways, such as p38 mitogen-activated protein kinases/MAPKs[1].
ACVR1 is involved in a wide variety of biological processes, including bone, heart, cartilage, nervous, and reproductive system development and regulation. Moreover, ACVR1 has been extensively studied for its causal role in fibrodysplasia ossificans progressiva (FOP). ACVR1 is linked to different pathologies, including cardiac malformations and alterations in the reproductive system. More recently, ACVR1 has been experimentally validated as a cancer driver gene in diffuse intrinsic pontine glioma (DIPG)[1].
In Vitro
Recombinant human ACVR1 (2.5-5 μg/mL) robustly down-regulates phosphorylated Smad1/5/8 and p38 MAPK levels in the HUVECR26H cells. ACVR1 also inhibits chondro-osseous differentiation in HUVECR26H cells[2].
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc;C-His
-
Accession
P37172 (V21-E123)
-
Molecular Construction
-
N-term
-
ACVR1 (V21-E123)
Accession # P37172 -
hFc-His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
ACVR1; Activin A Receptor, Type II-Like Kinase 2; Prev. ACVRLK2; Receptor Protein Serine/Threonine Kinase; SKR1; Hydroxyalkyl-Protein Kinase; TGF-B Superfamily Receptor Type I; Alternative Protein ACVR1; Activin Receptor Type-1; ACTR-I; Activin Receptor T
-
AA Sequence
VEDEKPKVNQKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLE
-
Predicted Molecular Mass
40 kDa
-
Molecular Weight
Approximately 45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
References
[1]. José Antonio Valer, et al. ACVR1 Function in Health and Disease. Cells. 2019 Oct 31;8(11):1366. [Content Brief]
[2]. Jing Pang, et al. ACVR1-Fc suppresses BMP signaling and chondro-osseous differentiation in an in vitro model of Fibrodysplasia ossificans progressive. Bone. 2016 Nov;92:29-36. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)