1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins Enzymes & Regulators
  3. TGF-beta Superfamily Receptor Serine/Threonine Kinases Cytokine Receptors Serine/Threonine Kinase Proteins
  4. Activin/Inhibins Receptor
  5. Activin A Receptor Type 2A (ACTR-IIA)
  6. ACVR2A/Activin RIIA Protein, Human/Cynomolgus (HEK293, Fc)

ACVR2A/Activin RIIA Protein, Human/Cynomolgus (HEK293, Fc)

Cat. No.: HY-P75537
Handling Instructions Technical Support

ACVR2A, also known as Activin RIIA, is an activin type II receptor. On ligand binding, ACVR2A can forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. ACVR2A is a receptor for Activin A, Activin B and Inhibin A. ACVR2A/Activin RIIA Protein, Human/Cynomolgus (HEK293, Fc) is produced in HEK293 cells with a C-Terminal Fc-tag. It consists of 134 amino acids (M1-P134).

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

ACVR2A, also known as Activin RIIA, is an activin type II receptor. On ligand binding, ACVR2A can forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. ACVR2A is a receptor for Activin A, Activin B and Inhibin A[1][2]. ACVR2A/Activin RIIA Protein, Human/Cynomolgus (HEK293, Fc) is produced in HEK293 cells with a C-Terminal Fc-tag. It consists of 134 amino acids (M1-P134).

Background

ACVR2A is a type II member of the TGF-β family of receptor Serine/Threonine kinases. ACVR2A is a receptor for Activin A, Activin B and Inhibin A[1][2].
The sequence of amino acids in ACVR2A proteins from different species is very stable, which leads to the conclusion that in the process of evolution, ACVR2A has been only slightly altered, and that both in humans and in animals, its function is similar.
Signaling by activins and BMPs is highly promiscuous, since apart from signaling through ALK4/7, the activin type II receptors (ACVR2A and 2B) can interact also with several type I BMP receptors (ALK1/2/3/6), which can also form complexes with the type II BMP receptor, BMPRII. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. ACVR2A can form complexes with different type I receptors that signal either to Smad2/3 (ALK4) or to Smad1/5/8 (ALK2, ALK3, ALK6). The different type I receptors compete for binding to ACVR2A and that this competition provides a mechanism that balances signaling between Activin A-mediated, ALK4-dependent Smad2/3 signaling, and BMP-mediated ALK2 or ALK3-dependent signaling to Smad1/5/8. In myeloma cells, BMP-6- and BMP-9-induced activation of SMAD1/5/8 through ACVR2A/ACVR2B/ALK2 is inhibited by activin A treatment[1][3].

In Vitro

Recombinant human ACVR2A (5 μg/mL) inhibits the effects of BMP-9 on INA-6 and IH-1 cells[1].
Recombinant human ACVR2A (1 μg/mL; 96 hours) blocks the β-cell-proliferative effect of adenoviruses containing mouse Pdx-1 (AdCMV-mPdx-1) treatment[4].

Biological Activity

1.This product does not contain protein kinase domain.
2.Immobilized Human Activin A, No Tag at 1μg/ml (100μl/well) on the plate. Dose response curve for Human Activin RIIA, hFc Tag with the EC50 of 1.6ng/ml determined by ELISA.
3.Measured by its ability to neutralize Activin-mediated inhibition on MPC-11 cell proliferation. The ED50 for this effect is typically 54.24 ng/mL in the presence of 10 ng/ml Recombinant Human Activin A, corresponding to a specific activity is 1.84×104 units/mg.

  • Measured by its ability to neutralize Activin-mediated inhibition on MPC-11 cell proliferation. The ED50 for this effect is typically 54.24 ng/mL in the presence of 10 ng/mL Recombinant Human Activin A, corresponding to a specific activity is 1.84×104 units/mg.
Assay Procedure

Cell Culture
ACVR2A/Activin RIIA Protein, Human (HEK293, Fc) (HY-P75537) Cell line used for viability testing: MPC-11 cells
Cell culture medium: DMEM + 10% HS + 1% P/S
Penicillin-Streptomycin (100×), Sterile (HY-K1006)
Cell Counting Kit-8 (CCK8, HY-K0301)
Activin A Protein, Human/Mouse/Rat (HEK293) (HY-P70311)

Procedure
1. Inoculate cells at a density of 15,000 cells/well in a 96-well plate, with a volume of 50 μL/well. (No cells were added to the circle around the 96-well plate, and an equal amount of PBS solution was added.)
2. Add 50 μL of complete medium (containing 10 ng/mL Activin A) containing different concentrations of Human ACVR2A protein into 96-well plate, so that the final concentration of Human ACVR2A protein in each well is 0, 0.01, 0.1 , 0.5, 1, 5, 10, 50, 100, 500, 1000, 5000, 10000 ng/mL.
3. Cells were cultured at 37°C in a 5% CO2 incubator for 72 h.
4. After reaching the incubation time, 10 μL of CCK8 solution was added to each well under light-avoidance condition and incubated at 37°C, 5% CO2 incubator for 3 h.
5. The optical density (OD) value at 450 nm was measured using a microplate reader.
6. Use GraphPad Prism software to plot a curve with the OD value as the y-axis and the Human ACVR2A protein concentration as the x-axis, then calculate the ED50 value.

Species

Human; Cynomolgus

Source

HEK293

Tag

C-hFc

Accession

P27037-1/G7PKJ4 (A20-P135)

Gene ID

92  [NCBI]/102121129

Molecular Construction
N-term
ACVR2A (A20-P134)
Accession # P27037-1
hFc
C-term
Protein Length

Extracellular Domain

Synonyms
ACVR-2A; Activin receptor type 2A; ACTR-IIA; ACVR2
AA Sequence

AILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPP

Molecular Weight

Approximately 55-70kDa due to the glycosylation.

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

ACVR2A/Activin RIIA Protein, Human/Cynomolgus (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ACVR2A/Activin RIIA Protein, Human/Cynomolgus (HEK293, Fc)
Cat. No.:
HY-P75537
Quantity:
MCE Japan Authorized Agent: